Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5787
Gene name
LocationContig_48:86277..87870
Strand+
Gene length (bp)1593
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13002 LDB19 Arrestin_N terminal like 2.8E-38 159 334

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10347|YDA5_SCHPO Uncharacterized protein C1F12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.05 PE=4 SV=1 100 488 6.0E-44
sp|O60150|YNSK_SCHPO Uncharacterized protein C18H10.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.20c PE=1 SV=1 103 489 5.0E-43
sp|Q75BI0|LDB19_ASHGO Protein LDB19 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LDB19 PE=3 SV=1 77 335 7.0E-30
sp|Q12502|LDB19_YEAST Protein LDB19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB19 PE=1 SV=1 162 333 1.0E-20
sp|Q12502|LDB19_YEAST Protein LDB19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB19 PE=1 SV=1 431 488 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10347|YDA5_SCHPO Uncharacterized protein C1F12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.05 PE=4 SV=1 100 488 6.0E-44
sp|O60150|YNSK_SCHPO Uncharacterized protein C18H10.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.20c PE=1 SV=1 103 489 5.0E-43
sp|Q75BI0|LDB19_ASHGO Protein LDB19 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LDB19 PE=3 SV=1 77 335 7.0E-30
sp|Q12502|LDB19_YEAST Protein LDB19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB19 PE=1 SV=1 162 333 1.0E-20
sp|Q12502|LDB19_YEAST Protein LDB19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB19 PE=1 SV=1 431 488 2.0E-08
sp|Q75BI0|LDB19_ASHGO Protein LDB19 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LDB19 PE=3 SV=1 439 488 5.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5787
MPHRVANFLRTSSGTIPHIKKKKSTTAANELSRNSSLAPTRNNSLTTSPDDSDSDDHHSPRIMPDHLAEAIRRHH
RLSFPFARSSGSSGASSSQGAGSGPVGLDWSVESPPIVFHGSAEDSTGALISGQMFMDVRAESVDVERFAACLEI
RVVHRRPFQNHCVDCQRQTTELKAWRLLGHTTTMKRGRHLFPFSALLDGKLPASIDTPVISISYHFRAEAVLVHS
PGSGPGSASPSASVTRVCFERPLDVKRSLPEPLYPHHSVRVFPPTNIKASAHYSAVIHPTGTNQLTLKLDGLLSR
NEKARTVDLWRLKKLTWRLEETVKTRAPACDKHAAAGTTPPPSGSEDEAAKKTVARTETRILGEKQLHDGWKSDF
GGTDGVVEMEFDFGVNQHQHHHQSSKSGPVSRYACDTKTPDGTEVTHSLLIELIVSKEYAPEGKTFLATQTGTGR
ILRMHFAVVMTEFPGLGVSWDNEAPPVYQDVPPSPPGYSPCRDGESPVEYEELEALDARRSSFDHRRQPSAGNSS
DGAED*
Coding >OphauB2|5787
ATGCCTCACCGCGTGGCCAACTTTTTGCGCACCTCGTCGGGCACTATCCCGCACATCAAGAAGAAGAAGTCGACA
ACGGCTGCCAACGAGTTGTCGCGCAATAGTTCCCTCGCCCCCACGCGCAACAACTCTCTCACCACCAGCCCCGAC
GACTCGGACTCGGACGACCACCACAGCCCCAGAATAATGCCGGACCACTTGGCCGAAGCCATTCGACGCCACCAC
CGCCTCTCCTTTCCCTTTGCGCGCTCGAGTGGAAGCAGCGGCGCCTCGAGTTCCCAGGGCGCTGGCTCGGGCCCC
GTTGGCCTCGACTGGAGCGTCGAGAGCCCGCCCATTGTCTTTCACGGATCGGCAGAGGACAGCACCGGCGCTCTC
ATTTCGGGCCAAATGTTTATGGACGTGCGCGCCGAAAGCGTCGACGTGGAGCGCTTTGCCGCCTGTCTCGAGATT
CGCGTCGTGCACCGCCGGCCCTTTCAGAATCACTGCGTCGACTGCCAGCGCCAGACGACGGAGCTCAAGGCCTGG
CGTCTGCTGGGCCACACCACCACGATGAAGCGTGGCCGCCACTTGTTTCCCTTTTCTGCCCTGCTTGACGGCAAG
CTGCCAGCCTCGATTGATACGCCCGTAATATCCATTTCCTACCACTTTCGTGCCGAGGCCGTTCTTGTCCACTCG
CCCGGCTCCGGTCCCGGCTCTGCGTCGCCCTCGGCCTCGGTCACGCGCGTTTGCTTTGAGCGGCCCCTCGACGTT
AAGCGCTCGCTGCCGGAGCCGCTCTACCCCCACCACTCGGTCCGTGTCTTCCCGCCAACAAACATCAAGGCCAGC
GCACACTACAGCGCCGTTATTCACCCTACCGGCACCAACCAGCTTACCCTCAAGCTCGACGGCCTCTTGTCTCGC
AACGAAAAGGCGCGGACGGTGGACCTGTGGCGCCTCAAGAAGCTGACGTGGCGCCTCGAAGAGACTGTAAAGACT
CGTGCTCCGGCCTGTGACAAGCACGCCGCCGCGGGGACGACGCCTCCGCCAAGCGGCTCGGAGGATGAAGCCGCC
AAGAAGACGGTGGCGCGCACCGAGACGCGCATCCTGGGCGAGAAGCAGCTGCACGACGGGTGGAAGTCTGACTTT
GGCGGCACCGACGGCGTGGTGGAGATGGAGTTTGACTTTGGCGTCAACCAGCACCAGCACCACCACCAGTCGTCC
AAGTCGGGTCCCGTGTCACGCTACGCCTGCGACACCAAGACGCCCGACGGCACCGAAGTGACGCACTCGCTGCTC
ATTGAGCTCATTGTCTCCAAGGAATACGCACCCGAGGGCAAGACCTTTTTGGCCACGCAGACGGGCACAGGCCGC
ATCTTGCGCATGCACTTTGCCGTGGTGATGACTGAGTTTCCCGGTCTGGGCGTCAGCTGGGACAATGAGGCGCCG
CCCGTGTACCAAGACGTGCCGCCCAGTCCGCCGGGGTACTCGCCGTGCCGCGATGGCGAGTCGCCGGTTGAGTAT
GAGGAGCTGGAGGCGCTGGATGCGCGGCGGTCGAGCTTTGATCACAGGCGGCAGCCGTCGGCAGGGAATAGCAGT
GATGGAGCTGAAGATTGA
Transcript >OphauB2|5787
ATGCCTCACCGCGTGGCCAACTTTTTGCGCACCTCGTCGGGCACTATCCCGCACATCAAGAAGAAGAAGTCGACA
ACGGCTGCCAACGAGTTGTCGCGCAATAGTTCCCTCGCCCCCACGCGCAACAACTCTCTCACCACCAGCCCCGAC
GACTCGGACTCGGACGACCACCACAGCCCCAGAATAATGCCGGACCACTTGGCCGAAGCCATTCGACGCCACCAC
CGCCTCTCCTTTCCCTTTGCGCGCTCGAGTGGAAGCAGCGGCGCCTCGAGTTCCCAGGGCGCTGGCTCGGGCCCC
GTTGGCCTCGACTGGAGCGTCGAGAGCCCGCCCATTGTCTTTCACGGATCGGCAGAGGACAGCACCGGCGCTCTC
ATTTCGGGCCAAATGTTTATGGACGTGCGCGCCGAAAGCGTCGACGTGGAGCGCTTTGCCGCCTGTCTCGAGATT
CGCGTCGTGCACCGCCGGCCCTTTCAGAATCACTGCGTCGACTGCCAGCGCCAGACGACGGAGCTCAAGGCCTGG
CGTCTGCTGGGCCACACCACCACGATGAAGCGTGGCCGCCACTTGTTTCCCTTTTCTGCCCTGCTTGACGGCAAG
CTGCCAGCCTCGATTGATACGCCCGTAATATCCATTTCCTACCACTTTCGTGCCGAGGCCGTTCTTGTCCACTCG
CCCGGCTCCGGTCCCGGCTCTGCGTCGCCCTCGGCCTCGGTCACGCGCGTTTGCTTTGAGCGGCCCCTCGACGTT
AAGCGCTCGCTGCCGGAGCCGCTCTACCCCCACCACTCGGTCCGTGTCTTCCCGCCAACAAACATCAAGGCCAGC
GCACACTACAGCGCCGTTATTCACCCTACCGGCACCAACCAGCTTACCCTCAAGCTCGACGGCCTCTTGTCTCGC
AACGAAAAGGCGCGGACGGTGGACCTGTGGCGCCTCAAGAAGCTGACGTGGCGCCTCGAAGAGACTGTAAAGACT
CGTGCTCCGGCCTGTGACAAGCACGCCGCCGCGGGGACGACGCCTCCGCCAAGCGGCTCGGAGGATGAAGCCGCC
AAGAAGACGGTGGCGCGCACCGAGACGCGCATCCTGGGCGAGAAGCAGCTGCACGACGGGTGGAAGTCTGACTTT
GGCGGCACCGACGGCGTGGTGGAGATGGAGTTTGACTTTGGCGTCAACCAGCACCAGCACCACCACCAGTCGTCC
AAGTCGGGTCCCGTGTCACGCTACGCCTGCGACACCAAGACGCCCGACGGCACCGAAGTGACGCACTCGCTGCTC
ATTGAGCTCATTGTCTCCAAGGAATACGCACCCGAGGGCAAGACCTTTTTGGCCACGCAGACGGGCACAGGCCGC
ATCTTGCGCATGCACTTTGCCGTGGTGATGACTGAGTTTCCCGGTCTGGGCGTCAGCTGGGACAATGAGGCGCCG
CCCGTGTACCAAGACGTGCCGCCCAGTCCGCCGGGGTACTCGCCGTGCCGCGATGGCGAGTCGCCGGTTGAGTAT
GAGGAGCTGGAGGCGCTGGATGCGCGGCGGTCGAGCTTTGATCACAGGCGGCAGCCGTCGGCAGGGAATAGCAGT
GATGGAGCTGAAGATTGA
Gene >OphauB2|5787
ATGCCTCACCGCGTGGCCAACTTTTTGCGCACCTCGTCGGGCACTATCCCGCACATCAAGAAGAAGAAGTCGACA
ACGGCTGCCAACGAGTTGTCGCGCAATAGTTCCCTCGCCCCCACGCGCAACAACTCTCTCACCACCAGCCCCGAC
GACTCGGACTCGGACGACCACCACAGCCCCAGAATAATGCCGGACCACTTGGCCGAAGCCATTCGACGCCACCAC
CGCCTCTCCTTTCCCTTTGCGCGCTCGAGTGGAAGCAGCGGCGCCTCGAGTTCCCAGGGCGCTGGCTCGGGCCCC
GTTGGCCTCGACTGGAGCGTCGAGAGCCCGCCCATTGTCTTTCACGGATCGGCAGAGGACAGCACCGGCGCTCTC
ATTTCGGGCCAAATGTTTATGGACGTGCGCGCCGAAAGCGTCGACGTGGAGCGCTTTGCCGCCTGTCTCGAGATT
CGCGTCGTGCACCGCCGGCCCTTTCAGAATCACTGCGTCGACTGCCAGCGCCAGACGACGGAGCTCAAGGCCTGG
CGTCTGCTGGGCCACACCACCACGATGAAGCGTGGCCGCCACTTGTTTCCCTTTTCTGCCCTGCTTGACGGCAAG
CTGCCAGCCTCGATTGATACGCCCGTAATATCCATTTCCTACCACTTTCGTGCCGAGGCCGTTCTTGTCCACTCG
CCCGGCTCCGGTCCCGGCTCTGCGTCGCCCTCGGCCTCGGTCACGCGCGTTTGCTTTGAGCGGCCCCTCGACGTT
AAGCGCTCGCTGCCGGAGCCGCTCTACCCCCACCACTCGGTCCGTGTCTTCCCGCCAACAAACATCAAGGCCAGC
GCACACTACAGCGCCGTTATTCACCCTACCGGCACCAACCAGCTTACCCTCAAGCTCGACGGCCTCTTGTCTCGC
AACGAAAAGGCGCGGACGGTGGACCTGTGGCGCCTCAAGAAGCTGACGTGGCGCCTCGAAGAGACTGTAAAGACT
CGTGCTCCGGCCTGTGACAAGCACGCCGCCGCGGGGACGACGCCTCCGCCAAGCGGCTCGGAGGATGAAGCCGCC
AAGAAGACGGTGGCGCGCACCGAGACGCGCATCCTGGGCGAGAAGCAGCTGCACGACGGGTGGAAGTCTGACTTT
GGCGGCACCGACGGCGTGGTGGAGATGGAGTTTGACTTTGGCGTCAACCAGCACCAGCACCACCACCAGTCGTCC
AAGTCGGGTCCCGTGTCACGCTACGCCTGCGACACCAAGACGCCCGACGGCACCGAAGTGACGCACTCGCTGCTC
ATTGAGCTCATTGTCTCCAAGGAATACGCACCCGAGGGCAAGACCTTTTTGGCCACGCAGACGGGCACAGGCCGC
ATCTTGCGCATGCACTTTGCCGTGGTGATGACTGAGTTTCCCGGTCTGGGCGTCAGCTGGGACAATGAGGCGCCG
CCCGTGTACCAAGACGTGCCGCCCAGTCCGCCGGGGTACTCGCCGTGCCGCGATGGCGAGTCGCCGGTTGAGTAT
GAGGAGCTGGAGGCGCTGGATGCGCGGCGGTCGAGCTTTGATCACAGGCGGCAGCCGTCGGCAGGGAATAGCAGT
GATGGAGCTGAAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail