Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5780
Gene name
LocationContig_48:62876..63640
Strand+
Gene length (bp)764
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01090 Ribosomal_S19e Ribosomal protein S19e 4.7E-57 6 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27073|RS19_EMENI 40S ribosomal protein S19 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rps19 PE=3 SV=1 3 140 1.0E-82
sp|P58234|RS19A_SCHPO 40S ribosomal protein S19-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1901 PE=2 SV=1 4 146 2.0E-62
sp|P07280|RS19A_YEAST 40S ribosomal protein S19-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS19A PE=1 SV=2 1 145 4.0E-62
sp|P07281|RS19B_YEAST 40S ribosomal protein S19-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS19B PE=1 SV=2 4 145 6.0E-62
sp|P79016|RS19B_SCHPO 40S ribosomal protein S19-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1902 PE=3 SV=2 4 145 5.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27073|RS19_EMENI 40S ribosomal protein S19 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rps19 PE=3 SV=1 3 140 1.0E-82
sp|P58234|RS19A_SCHPO 40S ribosomal protein S19-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1901 PE=2 SV=1 4 146 2.0E-62
sp|P07280|RS19A_YEAST 40S ribosomal protein S19-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS19A PE=1 SV=2 1 145 4.0E-62
sp|P07281|RS19B_YEAST 40S ribosomal protein S19-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS19B PE=1 SV=2 4 145 6.0E-62
sp|P79016|RS19B_SCHPO 40S ribosomal protein S19-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1902 PE=3 SV=2 4 145 5.0E-61
sp|Q8T5Z4|RS19_BRABE 40S ribosomal protein S19 OS=Branchiostoma belcheri GN=RPS19 PE=2 SV=1 1 143 8.0E-51
sp|Q9Y0H3|RS19_MYXGL 40S ribosomal protein S19 OS=Myxine glutinosa GN=rps19 PE=2 SV=1 1 137 7.0E-46
sp|P17074|RS19_RAT 40S ribosomal protein S19 OS=Rattus norvegicus GN=Rps19 PE=2 SV=3 1 147 1.0E-44
sp|Q9CZX8|RS19_MOUSE 40S ribosomal protein S19 OS=Mus musculus GN=Rps19 PE=1 SV=3 1 147 1.0E-44
sp|P39019|RS19_HUMAN 40S ribosomal protein S19 OS=Homo sapiens GN=RPS19 PE=1 SV=2 1 147 1.0E-43
sp|Q32PD5|RS19_BOVIN 40S ribosomal protein S19 OS=Bos taurus GN=RPS19 PE=2 SV=3 1 147 1.0E-43
sp|Q5R8M9|RS19_PONAB 40S ribosomal protein S19 OS=Pongo abelii GN=RPS19 PE=2 SV=3 1 147 1.0E-43
sp|Q9SGA6|RS191_ARATH 40S ribosomal protein S19-1 OS=Arabidopsis thaliana GN=RPS19A PE=2 SV=1 1 137 2.0E-43
sp|P61155|RS19_PAGMA 40S ribosomal protein S19 OS=Pagrus major GN=rps19 PE=2 SV=1 1 146 2.0E-43
sp|Q94613|RS19_MYAAR 40S ribosomal protein S19 OS=Mya arenaria GN=RPS19 PE=2 SV=1 4 141 3.0E-43
sp|Q90YQ4|RS19_ICTPU 40S ribosomal protein S19 OS=Ictalurus punctatus GN=rps19 PE=2 SV=1 1 147 4.0E-43
sp|Q9FNP8|RS193_ARATH 40S ribosomal protein S19-3 OS=Arabidopsis thaliana GN=RPS19C PE=2 SV=1 1 143 6.0E-43
sp|Q9LF30|RS192_ARATH 40S ribosomal protein S19-2 OS=Arabidopsis thaliana GN=RPS19B PE=2 SV=1 1 137 6.0E-43
sp|Q29308|RS19_PIG 40S ribosomal protein S19 (Fragment) OS=Sus scrofa GN=RPS19 PE=2 SV=3 1 137 2.0E-42
sp|Q9DFR5|RS19_GILMI 40S ribosomal protein S19 OS=Gillichthys mirabilis GN=rps19 PE=2 SV=1 1 146 2.0E-42
sp|P40978|RS19_ORYSJ 40S ribosomal protein S19 OS=Oryza sativa subsp. japonica GN=RPS19A PE=3 SV=1 6 137 7.0E-42
sp|Q8ITC3|RS19_ARGIR 40S ribosomal protein S19 OS=Argopecten irradians GN=RPS19 PE=2 SV=1 4 142 1.0E-41
sp|P39698|RS19S_ASCSU 40S ribosomal protein S19S OS=Ascaris suum GN=RPS19S PE=2 SV=1 6 137 1.0E-37
sp|Q54X51|RS19_DICDI 40S ribosomal protein S19 OS=Dictyostelium discoideum GN=rps19 PE=3 SV=1 5 138 1.0E-36
sp|P39018|RS19A_DROME 40S ribosomal protein S19a OS=Drosophila melanogaster GN=RpS19a PE=1 SV=3 1 138 1.0E-36
sp|O15631|RS19_ENTHI 40S ribosomal protein S19 OS=Entamoeba histolytica GN=RPS19 PE=2 SV=1 6 137 3.0E-36
sp|P24494|RS19G_ASCSU 40S ribosomal protein S19G OS=Ascaris suum GN=RPS19G PE=2 SV=1 1 144 4.0E-36
sp|Q7KS38|RS19B_DROME 40S ribosomal protein S19b OS=Drosophila melanogaster GN=RpS19b PE=2 SV=3 1 138 2.0E-35
sp|O18650|RS19_CAEEL 40S ribosomal protein S19 OS=Caenorhabditis elegans GN=rps-19 PE=2 SV=1 1 146 1.0E-33
sp|P54057|RS19E_METJA 30S ribosomal protein S19e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps19e PE=3 SV=1 5 138 6.0E-30
sp|O27653|RS19E_METTH 30S ribosomal protein S19e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps19e PE=3 SV=1 6 137 5.0E-27
sp|Q9V0G8|RS19E_PYRAB 30S ribosomal protein S19e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps19e PE=1 SV=1 6 146 1.0E-24
sp|O59041|RS19E_PYRHO 30S ribosomal protein S19e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps19e PE=3 SV=1 6 146 2.0E-24
sp|O28210|RS19E_ARCFU 30S ribosomal protein S19e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps19e PE=3 SV=1 6 137 3.0E-22
sp|Q9YD22|RS19E_AERPE 30S ribosomal protein S19e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps19e PE=3 SV=1 32 142 3.0E-19
sp|P19952|RS19E_HALMA 30S ribosomal protein S19e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps19e PE=1 SV=3 6 137 8.0E-17
sp|Q97CU4|RS19E_THEVO 30S ribosomal protein S19e OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps19e PE=3 SV=1 5 149 2.0E-15
sp|Q8SQS8|RS19_ENCCU 40S ribosomal protein S19 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS19 PE=1 SV=1 7 116 1.0E-14
sp|Q9HM21|RS19E_THEAC 30S ribosomal protein S19e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps19e PE=3 SV=1 5 144 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5780
MPGGITVRDVDAQKFITAYAAFLKRQGKLPIPGWVDTVKTGPAKELPPQDIDWFYVRVASIARHVYMRKAVGVGR
LRKAHGSAKNRGSRPSKHVDASGSVDRKAMQALEKIGVLEQDEEKGGRRITQAGQRDLDRIAQTTAEADEEEEE*
Coding >OphauB2|5780
ATGCCTGGCGGAATCACTGTGCGCGACGTCGATGCGCAAAAATTCATTACTGCATATGCAGCCTTTTTGAAGCGC
CAGGGCAAGCTGCCCATTCCCGGCTGGGTCGACACGGTCAAGACGGGACCGGCCAAGGAGCTGCCACCGCAAGAC
ATTGACTGGTTCTACGTGCGCGTCGCGTCTATTGCGCGCCACGTTTACATGCGCAAGGCGGTGGGCGTTGGGCGC
TTGCGCAAGGCTCACGGCTCGGCCAAGAACCGCGGCAGCCGGCCGTCCAAGCACGTGGACGCCTCTGGCTCTGTG
GACCGCAAGGCGATGCAGGCGCTGGAAAAGATTGGCGTGCTGGAGCAGGATGAGGAAAAGGGCGGGCGGCGGATT
ACGCAGGCGGGCCAGCGAGACTTGGACCGTATTGCGCAGACGACGGCCGAGGCTGACGAGGAGGAGGAGGAGTAG
Transcript >OphauB2|5780
ATGCCTGGCGGAATCACTGTGCGCGACGTCGATGCGCAAAAATTCATTACTGCATATGCAGCCTTTTTGAAGCGC
CAGGGCAAGCTGCCCATTCCCGGCTGGGTCGACACGGTCAAGACGGGACCGGCCAAGGAGCTGCCACCGCAAGAC
ATTGACTGGTTCTACGTGCGCGTCGCGTCTATTGCGCGCCACGTTTACATGCGCAAGGCGGTGGGCGTTGGGCGC
TTGCGCAAGGCTCACGGCTCGGCCAAGAACCGCGGCAGCCGGCCGTCCAAGCACGTGGACGCCTCTGGCTCTGTG
GACCGCAAGGCGATGCAGGCGCTGGAAAAGATTGGCGTGCTGGAGCAGGATGAGGAAAAGGGCGGGCGGCGGATT
ACGCAGGCGGGCCAGCGAGACTTGGACCGTATTGCGCAGACGACGGCCGAGGCTGACGAGGAGGAGGAGGAGTAG
Gene >OphauB2|5780
ATGCCTGGCGGAATCACTGTGCGCGACGTCGATGTAGGTTACTCCTGAAAGAATGAATACCCAAGCCGAAGCCCC
AAACGACCAAAAAAAAAACTGCACCCAGACTTGCGGCAAACCGCAAAAAAAAAACCAAGGCCGTAATGGGTCCAA
AAACGCAGCGGGCAGACAAGATATTCGAGGGAGCAGGCGTGAGGGAGTCGCAAGACTTCTGAAGACGGAATATGC
TGATGGGATACCTTTGTCTGCCAGGCGCAAAAATTCATTACTGCATATGCAGCCTTTTTGAAGCGCCAGGGCAAG
CTGCCCATTCCCGGTATGTCCCCAGAGCCTGTCCTTTTTTGCATCTTGTTCTTTAGCAAAGCAAGAAGCATTATT
TAGCCATGGAGTCCTTTTTTTTGCTGACGAGCATAGGCTGGGTCGACACGGTCAAGACGGGACCGGCCAAGGAGC
TGCCACCGCAAGACATTGACTGGTTCTACGTGCGCGTCGCGTCTATTGCGCGCCACGTTTACATGCGCAAGGCGG
TGGGCGTTGGGCGCTTGCGCAAGGCTCACGGCTCGGCCAAGAACCGCGGCAGCCGGCCGTCCAAGCACGTGGACG
CCTCTGGCTCTGTGGACCGCAAGGCGATGCAGGCGCTGGAAAAGATTGGCGTGCTGGAGCAGGATGAGGAAAAGG
GCGGGCGGCGGATTACGCAGGCGGGCCAGCGAGACTTGGACCGTATTGCGCAGACGACGGCCGAGGCTGACGAGG
AGGAGGAGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail