Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5778
Gene name
LocationContig_48:56440..57966
Strand+
Gene length (bp)1526
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12519 MDM10 Mitochondrial distribution and morphology protein 10 1.1E-147 1 446

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H740|MDM10_CHAGB Mitochondrial distribution and morphology protein 10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDM10 PE=3 SV=2 1 424 5.0E-156
sp|Q7SBE0|MDM10_NEUCR Mitochondrial distribution and morphology protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdm10 PE=3 SV=4 1 446 5.0E-155
sp|O13498|MDM10_PODAN Mitochondrial distribution and morphology protein 10 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MDM10 PE=3 SV=1 1 446 8.0E-147
sp|A4QTI8|MDM10_MAGO7 Mitochondrial distribution and morphology protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDM10 PE=3 SV=1 1 446 2.0E-135
sp|A7F1G7|MDM10_SCLS1 Mitochondrial distribution and morphology protein 10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdm10 PE=3 SV=1 1 446 3.0E-132
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H740|MDM10_CHAGB Mitochondrial distribution and morphology protein 10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDM10 PE=3 SV=2 1 424 5.0E-156
sp|Q7SBE0|MDM10_NEUCR Mitochondrial distribution and morphology protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdm10 PE=3 SV=4 1 446 5.0E-155
sp|O13498|MDM10_PODAN Mitochondrial distribution and morphology protein 10 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MDM10 PE=3 SV=1 1 446 8.0E-147
sp|A4QTI8|MDM10_MAGO7 Mitochondrial distribution and morphology protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDM10 PE=3 SV=1 1 446 2.0E-135
sp|A7F1G7|MDM10_SCLS1 Mitochondrial distribution and morphology protein 10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdm10 PE=3 SV=1 1 446 3.0E-132
sp|Q0TWV0|MDM10_PHANO Mitochondrial distribution and morphology protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDM10 PE=3 SV=1 1 446 6.0E-114
sp|Q0CJH2|MDM10_ASPTN Mitochondrial distribution and morphology protein 10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdmB PE=3 SV=1 1 423 3.0E-64
sp|Q6CAG4|MDM10_YARLI Mitochondrial distribution and morphology protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM10 PE=3 SV=1 1 313 7.0E-64
sp|B0Y240|MDM10_ASPFC Mitochondrial distribution and morphology protein 10 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mdmB PE=3 SV=1 1 436 2.0E-63
sp|A6QYP4|MDM10_AJECN Mitochondrial distribution and morphology protein 10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MDM10 PE=3 SV=1 1 423 6.0E-63
sp|C0NFC2|MDM10_AJECG Mitochondrial distribution and morphology protein 10 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MDM10 PE=3 SV=1 1 423 1.0E-61
sp|Q4WVV6|MDM10_ASPFU Mitochondrial distribution and morphology protein 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdmB PE=3 SV=1 1 436 3.0E-61
sp|C1GVA2|MDM10_PARBA Mitochondrial distribution and morphology protein 10 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=MDM10 PE=3 SV=3 1 423 3.0E-61
sp|A1DDI7|MDM10_NEOFI Mitochondrial distribution and morphology protein 10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdmB PE=3 SV=1 1 423 1.0E-60
sp|A2R3N6|MDM10_ASPNC Mitochondrial distribution and morphology protein 10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdmB PE=3 SV=1 1 445 2.0E-59
sp|C4JV00|MDM10_UNCRE Mitochondrial distribution and morphology protein 10 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MDM10 PE=3 SV=1 1 423 1.0E-57
sp|B8NM08|MDM10_ASPFN Mitochondrial distribution and morphology protein 10 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mdmB PE=3 SV=1 1 423 1.0E-57
sp|A1CBT0|MDM10_ASPCL Mitochondrial distribution and morphology protein 10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdmB PE=3 SV=1 1 423 2.0E-57
sp|Q2U5V7|MDM10_ASPOR Mitochondrial distribution and morphology protein 10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdmB PE=3 SV=1 1 423 1.0E-56
sp|Q8J0L4|MDM10_EMENI Mitochondrial distribution and morphology protein 10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdmB PE=3 SV=1 1 423 2.0E-56
sp|B6HL48|MDM10_PENRW Mitochondrial distribution and morphology protein 10 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mdm10 PE=3 SV=1 1 423 6.0E-56
sp|Q1DK03|MDM10_COCIM Mitochondrial distribution and morphology protein 10 OS=Coccidioides immitis (strain RS) GN=MDM10 PE=3 SV=1 1 423 9.0E-56
sp|C5GL32|MDM10_AJEDR Mitochondrial distribution and morphology protein 10 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MDM10 PE=3 SV=1 1 423 5.0E-55
sp|C5K0G3|MDM10_AJEDS Mitochondrial distribution and morphology protein 10 OS=Ajellomyces dermatitidis (strain SLH14081) GN=MDM10 PE=3 SV=1 1 423 6.0E-55
sp|A8NWS6|MDM10_COPC7 Mitochondrial distribution and morphology protein 10 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MDM10 PE=3 SV=1 1 446 9.0E-55
sp|B6Q6B6|MDM10_TALMQ Mitochondrial distribution and morphology protein 10 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mdm10 PE=3 SV=1 1 423 7.0E-53
sp|C4XVQ6|MDM10_CLAL4 Mitochondrial distribution and morphology protein 10 OS=Clavispora lusitaniae (strain ATCC 42720) GN=MDM10 PE=3 SV=1 1 438 9.0E-53
sp|B9WBE5|MDM10_CANDC Mitochondrial distribution and morphology protein 10 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MDM10 PE=3 SV=1 1 444 2.0E-52
sp|B8LYF6|MDM10_TALSN Mitochondrial distribution and morphology protein 10 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mdm10 PE=3 SV=1 1 423 8.0E-52
sp|C5DG70|MDM10_LACTC Mitochondrial distribution and morphology protein 10 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MDM10 PE=3 SV=1 1 434 3.0E-50
sp|B8P366|MDM10_POSPM Mitochondrial distribution and morphology protein 10 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=MDM10 PE=3 SV=1 1 446 1.0E-49
sp|Q6BTX9|MDM10_DEBHA Mitochondrial distribution and morphology protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MDM10 PE=3 SV=2 1 311 1.0E-48
sp|Q59LL4|MDM10_CANAL Mitochondrial distribution and morphology protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDM10 PE=3 SV=1 1 312 1.0E-48
sp|C5M6Z4|MDM10_CANTT Mitochondrial distribution and morphology protein 10 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MDM10 PE=3 SV=1 1 445 2.0E-48
sp|O13814|MDM10_SCHPO Mitochondrial distribution and morphology protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm10 PE=1 SV=1 1 313 9.0E-48
sp|C4YIG3|MDM10_CANAW Mitochondrial distribution and morphology protein 10 OS=Candida albicans (strain WO-1) GN=MDM10 PE=3 SV=1 1 312 1.0E-47
sp|C5FMP1|MDM10_ARTOC Mitochondrial distribution and morphology protein 10 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MDM10 PE=3 SV=2 1 423 8.0E-47
sp|A3LT10|MDM10_PICST Mitochondrial distribution and morphology protein 10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MDM10 PE=3 SV=2 1 429 3.0E-46
sp|A5DCL4|MDM10_PICGU Mitochondrial distribution and morphology protein 10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MDM10 PE=3 SV=3 1 429 4.0E-46
sp|B0DK33|MDM10_LACBS Mitochondrial distribution and morphology protein 10 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MDM10 PE=3 SV=1 1 312 6.0E-46
sp|P0CO67|MDM10_CRYNB Mitochondrial distribution and morphology protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDM10 PE=3 SV=1 1 446 3.0E-45
sp|P0CO66|MDM10_CRYNJ Mitochondrial distribution and morphology protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDM10 PE=3 SV=1 1 446 1.0E-44
sp|B6K463|MDM10_SCHJY Mitochondrial distribution and morphology protein 10 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mdm10 PE=3 SV=1 1 333 3.0E-42
sp|A5DUG6|MDM10_LODEL Mitochondrial distribution and morphology protein 10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MDM10 PE=3 SV=1 1 312 3.0E-41
sp|Q6CKU5|MDM10_KLULA Mitochondrial distribution and morphology protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDM10 PE=3 SV=1 1 426 4.0E-41
sp|C4QWJ4|MDM10_PICPG Mitochondrial distribution and morphology protein 10 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MDM10 PE=3 SV=1 1 446 6.0E-41
sp|P18409|MDM10_YEAST Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM10 PE=1 SV=5 1 430 2.0E-40
sp|A7A0F9|MDM10_YEAS7 Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDM10 PE=3 SV=1 1 430 4.0E-40
sp|C5E1U4|MDM10_ZYGRC Mitochondrial distribution and morphology protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=MDM10 PE=3 SV=1 1 426 3.0E-39
sp|B5VDL3|MDM10_YEAS6 Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MDM10 PE=3 SV=1 1 327 9.0E-39
sp|B3LUU7|MDM10_YEAS1 Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MDM10 PE=3 SV=1 1 327 9.0E-39
sp|Q758T7|MDM10_ASHGO Mitochondrial distribution and morphology protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDM10 PE=3 SV=2 1 434 3.0E-37
sp|Q6FWV0|MDM10_CANGA Mitochondrial distribution and morphology protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDM10 PE=3 SV=1 1 446 9.0E-36
sp|A7TNL0|MDM10_VANPO Mitochondrial distribution and morphology protein 10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDM10 PE=3 SV=1 1 446 3.0E-29
sp|Q4PEP6|MDM10_USTMA Mitochondrial distribution and morphology protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDM10 PE=3 SV=1 170 428 6.0E-20
sp|Q4PEP6|MDM10_USTMA Mitochondrial distribution and morphology protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDM10 PE=3 SV=1 1 156 6.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0032865 ERMES complex Yes
GO:0007005 mitochondrion organization Yes
GO:0032991 protein-containing complex No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0005575 cellular_component No
GO:0098796 membrane protein complex No
GO:0098799 outer mitochondrial membrane protein complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5778
MREFMDHVHSAFYEATGWRRDNSYAALNATSDALLNFATPRGLRLTLSSLASPNFATSYQLGSVGVVDGSMAYLF
SSVPLRVLLTSQSATVPLPELLRAYRPLTPLLAGRVAQRGVDAPTPSLLYGRLYLPQSQLEALAVRRFSPALQMQ
LSAVSAAHLRDGGTLLGLAQYDVGKCAFEGLASSDGGLLGLRGVYNFGGDADSWAASRSDGAEASTGLNGAGDRI
YGRFTTGGEVYYGTLNKSGGMSLGARFATLPEHCGTPLSATMTLNPLMGSVAASYAVVAGRHCSLATRMEFNVLS
YESAWAVGMELWRKPFGRLVAADNGDDDDDEGGPQARRFALKERSWPAKLEWRLDSNAEAPKPPAPRLRNRAMSA
ELGEPTSREAGDSSDQGYAGVLKTRLDQNLRIGVLWEGRAKSLLFSLGSDIDLKRLDKPFRTLGLEIQFSS*
Coding >OphauB2|5778
ATGCGCGAGTTTATGGACCATGTCCACAGCGCCTTTTACGAGGCGACGGGCTGGCGGCGCGACAATTCCTATGCG
GCGCTCAATGCCACTTCGGACGCGCTGCTCAACTTTGCCACGCCACGAGGCCTTCGTCTGACCCTGTCGTCACTG
GCCAGCCCCAACTTTGCCACGTCGTACCAGCTGGGCTCGGTTGGCGTCGTTGATGGCTCCATGGCATACCTCTTT
TCGTCGGTGCCGCTGCGCGTGCTGCTGACGTCGCAGTCAGCCACGGTGCCGCTGCCTGAGCTACTACGCGCCTAC
CGCCCCTTGACTCCGCTGCTGGCTGGCCGAGTCGCGCAACGGGGCGTCGACGCGCCCACGCCCTCGCTGCTGTAC
GGGAGGCTCTACCTGCCCCAGTCGCAGCTCGAGGCTCTGGCTGTGAGACGCTTCTCGCCCGCGCTGCAGATGCAG
CTGAGCGCAGTGTCGGCTGCGCACCTACGCGACGGCGGGACCCTCCTTGGCCTGGCACAGTACGACGTGGGCAAG
TGCGCCTTTGAGGGCCTGGCGTCGAGCGATGGCGGCCTGTTGGGGCTGCGTGGCGTGTACAACTTTGGCGGCGAT
GCCGACTCTTGGGCGGCCAGTCGCTCCGACGGGGCAGAGGCTAGCACCGGCTTAAACGGCGCGGGCGACCGCATC
TACGGCCGCTTCACCACTGGCGGTGAAGTCTACTATGGTACACTTAACAAGTCGGGCGGCATGAGTCTGGGCGCC
AGGTTTGCTACACTGCCGGAACATTGCGGAACACCGCTGTCGGCAACCATGACGCTCAATCCCCTCATGGGCAGC
GTGGCAGCGAGCTATGCCGTCGTGGCGGGGCGGCACTGCAGCCTGGCGACGCGCATGGAGTTCAATGTGCTGAGC
TACGAGAGCGCTTGGGCCGTGGGCATGGAGCTATGGCGCAAGCCCTTTGGCCGGCTAGTCGCTGCAGACAATGGC
GACGACGACGACGACGAGGGCGGTCCCCAAGCACGGCGATTTGCGCTAAAGGAACGTAGCTGGCCGGCCAAGCTG
GAGTGGAGGCTCGACAGTAATGCCGAGGCGCCCAAGCCCCCGGCACCGAGGCTGCGCAACAGGGCCATGTCTGCC
GAGCTGGGCGAGCCGACTAGCCGCGAGGCTGGCGACTCGAGCGACCAAGGGTATGCCGGGGTGCTCAAGACGAGG
CTGGATCAGAATCTACGCATTGGCGTGTTGTGGGAAGGGCGGGCCAAGTCGCTACTCTTTAGCCTGGGCAGCGAC
ATTGATTTGAAGAGGCTCGACAAGCCGTTTCGGACGCTGGGACTCGAGATTCAGTTTTCGTCGTGA
Transcript >OphauB2|5778
ATGCGCGAGTTTATGGACCATGTCCACAGCGCCTTTTACGAGGCGACGGGCTGGCGGCGCGACAATTCCTATGCG
GCGCTCAATGCCACTTCGGACGCGCTGCTCAACTTTGCCACGCCACGAGGCCTTCGTCTGACCCTGTCGTCACTG
GCCAGCCCCAACTTTGCCACGTCGTACCAGCTGGGCTCGGTTGGCGTCGTTGATGGCTCCATGGCATACCTCTTT
TCGTCGGTGCCGCTGCGCGTGCTGCTGACGTCGCAGTCAGCCACGGTGCCGCTGCCTGAGCTACTACGCGCCTAC
CGCCCCTTGACTCCGCTGCTGGCTGGCCGAGTCGCGCAACGGGGCGTCGACGCGCCCACGCCCTCGCTGCTGTAC
GGGAGGCTCTACCTGCCCCAGTCGCAGCTCGAGGCTCTGGCTGTGAGACGCTTCTCGCCCGCGCTGCAGATGCAG
CTGAGCGCAGTGTCGGCTGCGCACCTACGCGACGGCGGGACCCTCCTTGGCCTGGCACAGTACGACGTGGGCAAG
TGCGCCTTTGAGGGCCTGGCGTCGAGCGATGGCGGCCTGTTGGGGCTGCGTGGCGTGTACAACTTTGGCGGCGAT
GCCGACTCTTGGGCGGCCAGTCGCTCCGACGGGGCAGAGGCTAGCACCGGCTTAAACGGCGCGGGCGACCGCATC
TACGGCCGCTTCACCACTGGCGGTGAAGTCTACTATGGTACACTTAACAAGTCGGGCGGCATGAGTCTGGGCGCC
AGGTTTGCTACACTGCCGGAACATTGCGGAACACCGCTGTCGGCAACCATGACGCTCAATCCCCTCATGGGCAGC
GTGGCAGCGAGCTATGCCGTCGTGGCGGGGCGGCACTGCAGCCTGGCGACGCGCATGGAGTTCAATGTGCTGAGC
TACGAGAGCGCTTGGGCCGTGGGCATGGAGCTATGGCGCAAGCCCTTTGGCCGGCTAGTCGCTGCAGACAATGGC
GACGACGACGACGACGAGGGCGGTCCCCAAGCACGGCGATTTGCGCTAAAGGAACGTAGCTGGCCGGCCAAGCTG
GAGTGGAGGCTCGACAGTAATGCCGAGGCGCCCAAGCCCCCGGCACCGAGGCTGCGCAACAGGGCCATGTCTGCC
GAGCTGGGCGAGCCGACTAGCCGCGAGGCTGGCGACTCGAGCGACCAAGGGTATGCCGGGGTGCTCAAGACGAGG
CTGGATCAGAATCTACGCATTGGCGTGTTGTGGGAAGGGCGGGCCAAGTCGCTACTCTTTAGCCTGGGCAGCGAC
ATTGATTTGAAGAGGCTCGACAAGCCGTTTCGGACGCTGGGACTCGAGATTCAGTTTTCGTCGTGA
Gene >OphauB2|5778
ATGCGCGAGTTTATGGACCATGTCCACAGCGCCTTTTACGAGGCGACGGGCTGGCGGCGCGACAATTCCTATGCG
GCGCTCAATGCCACTTCGGACGGCACGTCTTTTTTCCTTTTTGATGCAGCACTGCTTTACAATCTCTTGAAATCT
CTCTTGATGCAGCACCCTTTTGCAGTTCCTTGAAATCTTGATATGTAGCACCGCTTTACAAACCTCTTGTCGACG
CAGCATCTCTTGACAATCCCCCTGCCCAAAAAGATGGCTTGGCTGACATTTGCGCAGCGCTGCTCAACTTTGCCA
CGCCACGAGGCCTTCGTCTGACCCTGTCGTCACTGGCCAGCCCCAACTTTGCCACGTCGTACCAGCTGGGCTCGG
TTGGCGTCGTTGATGGCTCCATGGCATACCTCTTTTCGTCGGTGCCGCTGCGCGTGCTGCTGACGTCGCAGTCAG
CCACGGTGCCGCTGCCTGAGCTACTACGCGCCTACCGCCCCTTGACTCCGCTGCTGGCTGGCCGAGTCGCGCAAC
GGGGCGTCGACGCGCCCACGCCCTCGCTGCTGTACGGGAGGCTCTACCTGCCCCAGTCGCAGCTCGAGGCTCTGG
CTGTGAGACGCTTCTCGCCCGCGCTGCAGATGCAGCTGAGCGCAGTGTCGGCTGCGCACCTACGCGACGGCGGGA
CCCTCCTTGGCCTGGCACAGTACGACGTGGGCAAGTGCGCCTTTGAGGGCCTGGCGTCGAGCGATGGCGGCCTGT
TGGGGCTGCGTGGCGTGTACAACTTTGGCGGCGATGCCGACTCTTGGGCGGCCAGTCGCTCCGACGGGGCAGAGG
CTAGCACCGGCTTAAACGGCGCGGGCGACCGCATCTACGGCCGCTTCACCACTGGCGGTGAAGTCTACTATGGTA
CACTTAACAAGTCGGGCGGCATGAGTCTGGGCGCCAGGTTTGCTACACTGCCGGAACATTGCGGAACACCGCTGT
CGGCAACCATGACGCTCAATCCCCTCATGGGCAGCGTGGCAGCGAGCTATGCCGTCGTGGCGGGGCGGCACTGCA
GCCTGGCGACGCGCATGGAGTTCAATGTGCTGAGCTACGAGAGCGCTTGGGCCGTGGGCATGGAGCTATGGCGCA
AGCCCTTTGGCCGGCTAGTCGCTGCAGACAATGGCGACGACGACGACGACGAGGGCGGTCCCCAAGCACGGCGAT
TTGCGCTAAAGGAACGTAGCTGGCCGGCCAAGCTGGAGTGGAGGCTCGACAGTAATGCCGAGGCGCCCAAGCCCC
CGGCACCGAGGCTGCGCAACAGGGCCATGTCTGCCGAGCTGGGCGAGCCGACTAGCCGCGAGGCTGGCGACTCGA
GCGACCAAGGGTATGCCGGGGTGCTCAAGACGAGGCTGGATCAGAATCTACGCATTGGCGTGTTGTGGGAAGGGC
GGGCCAAGTCGCTACTCTTTAGCCTGGGCAGCGACATTGATTTGAAGAGGCTCGACAAGCCGTTTCGGACGCTGG
GACTCGAGATTCAGTTTTCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail