Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5771
Gene name
LocationContig_48:34658..43574
Strand+
Gene length (bp)8916
Transcript length (bp)8916
Coding sequence length (bp)8916
Protein length (aa) 2972

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10344 Fmp27 Mitochondrial protein from FMP27 2.6E-200 17 907
PF10351 Apt1 Golgi-body localisation protein domain 1.2E-195 2174 2722
PF10359 Fmp27_WPPW RNA pol II promoter Fmp27 protein domain 3.5E-170 1662 2161
PF10347 Fmp27_GFWDK RNA pol II promoter Fmp27 protein domain 8.9E-52 1263 1420
PF10293 DUF2405 Domain of unknown function (DUF2405) 5.0E-49 924 1081
PF10305 Fmp27_SW RNA pol II promoter Fmp27 protein domain 8.3E-28 1144 1245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 938 2521 0.0E+00
sp|Q06179|FMP27_YEAST Protein FMP27, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP27 PE=1 SV=1 922 2478 1.0E-143
sp|Q06116|YP117_YEAST Uncharacterized protein YPR117W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR117W PE=1 SV=1 892 2483 1.0E-143
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 339 711 1.0E-21
sp|Q06179|FMP27_YEAST Protein FMP27, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP27 PE=1 SV=1 2572 2759 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 938 2521 0.0E+00
sp|Q06179|FMP27_YEAST Protein FMP27, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP27 PE=1 SV=1 922 2478 1.0E-143
sp|Q06116|YP117_YEAST Uncharacterized protein YPR117W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR117W PE=1 SV=1 892 2483 1.0E-143
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 339 711 1.0E-21
sp|Q06179|FMP27_YEAST Protein FMP27, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP27 PE=1 SV=1 2572 2759 3.0E-17
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 2645 2758 1.0E-12
sp|Q06116|YP117_YEAST Uncharacterized protein YPR117W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR117W PE=1 SV=1 2617 2775 4.0E-11
sp|Q14667|K0100_HUMAN Protein KIAA0100 OS=Homo sapiens GN=KIAA0100 PE=1 SV=3 2624 2743 1.0E-10
sp|Q5SYL3|K0100_MOUSE Protein KIAA0100 OS=Mus musculus GN=Kiaa0100 PE=1 SV=1 2624 2730 2.0E-10
sp|Q14667|K0100_HUMAN Protein KIAA0100 OS=Homo sapiens GN=KIAA0100 PE=1 SV=3 2234 2481 1.0E-09
sp|Q5SYL3|K0100_MOUSE Protein KIAA0100 OS=Mus musculus GN=Kiaa0100 PE=1 SV=1 2234 2481 7.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5771
MALLNPTFLLGLVVLGYLSSFVLFAILRIVTGISIQRIGYLSLRRLAYTPKDGLRVEIRGLGFSIHRPTFAQPTW
ISLALDELTITIDVAELEGLKAKDDEDEKEGPQHGVDDVTGAEAKTAPLLPATPLPKERASNGHTHGTAAPGETW
KKLADFKEKLKRLHGKIDWIRMVDVVATGSTINVVGVGNVQIGSCTLAVDTRNKIVDRARFFFQRSKSRQQRHQQ
AEWIMTLRSVLFTADGNESLEVLDHALFNVHGFLYQSKQGLLDATIALKLGRVHVPYDDIQTCLEKLARCRHQAV
HPPAEQDEPLDGYVDQLAQEFQNPGSTSDDLMKTVSDSKDFFSSILGGIKEIQFAVSFVGFSTRVTSIHPATNAI
VLNAAMKEVGFDLHRLDPKSPAHRMYFSSKDIAHEALAAALSISVGLDDGTGRPERLVYIPMATTTVRTTLPSKT
VQLAHSGNLEEKNANILFSNSVVTSPSVDLNPRHLPLLIALMRPKPKAPQPRHSASSHLISRLLPKANIKFSMHE
PVMRIKLQPMQELQDPDDYDLIISSISSVSLDVESSPSSVQDLHYFLDGSMRLQSHRLYYQTCTNDIFNLITTES
CDIKANLAAEPDVCVDVTSSMQCFSISMARPEITHGLRQIVQQLRINVEPDKRSSSKSHKHRTFLRSAPSWLKRS
RFEASDFNVEVAGIDEEISDETRGVSLHLDSFTAEYRARQLGGPERWTPRRRTHSRCINPCDSEPATPASPSLKK
KTKNHGDGRLLTMHARGLEAQVVESVDRVETEPFLRLPRLELTMIARSDRTGPVFEIISVIKTISFNYSLYRHYA
IGVAGMTLRKAFMMTARDNPRPQQQHHGEQDEHLSPGHHGSAGDSSSTLSVSDELVSVSVKAFFVQIKAEMPHEP
QMLLHIHDLNASRARWSAPCFSANLIRFCIEPPRMRNVWSRMLSIKGMRAEWCETRQKTARGDLIDDNMINITSD
AVRLAVPHEVVVSQIQDNCVNVVKAVAQLHHRFKTGTNEYILDKKPEGPKKVPKMRIRAENFLLELEDGAFEWKL
GIIYRAGRIEQIQRLAREEAFLYKAKKAREQARKGRSRSIAARGRTAHGSSSSAWFRSHSEDGRVGAAHMRPRYD
PEGDSIGINGNAKVGEEEARARLNVFNAQSWQQRINLAYQESQDRVKEQRVVFWGNDELPQEVEVTEKILAVPPR
PALLSAVMRALVVNIDKPSFAMQSLPDFIHRVGKGMPRDMKYGLLVPMHIGITMTEALISLRDYPLPLLHIPGFK
GSHRPGTVSIQANFVVAEEFRGMESTRRVLVNVVPPRHTGPDSTKHGSFAIEVRRTIGPIKSFSEVDMDIHTGLP
TRITWAPCYQPAIQDVMMVIESFTKPPVDPSERVGFWDKIRLTMHSRVHVAWKGDGDMHLVLKGSRDPYYVTGTG
AGFIMCWRNEVRWNINCEDDPKRFMTVDSGEFIWAVPDFSYLVRSAAQRDGRFLDSGSRSGAAFQKVVMKLSGKV
QWMAGLVFEQAIEGGKRNFDFVPHYDVVLKHPHFAKPDDDGLPYDAMRGFRSRHIHLSIAVRAPADRDWTSQFPE
PSRSYNTVHFTPRFFTHFFQWWALFSQQTMPIRQGSLFPAREKNSKKFGRHLATVKYSLLLAPLFLSHIYKHKDA
EDYAEDAVSATGLKVRFDSWMLDLHQRREEFNTLGKGRNAQGRTSAIKIHAAQLDLASADVRAVSASIKGTTTEA
IKKGSLAGLVVDQDDKPDLSKFIIPDNDFSWIDMDDFVELDWILPTEPHPRTKILPLAFAPRLTYFRQTDIGGTI
AGDPSRTSPFGSEPTHFCITSYDDDPKRVQGELVQERLDQLEDQMLQHSRDVGDAELKVIQMNAQDGELVANLEA
LRKHSGVLKDKKIFLENMLEQIQGDGGRRSSLAPGDGQETLDLPSAARFESEFTNRFVIHNMQLKWNNMLRNIVL
RYIHQNSQRRGFVYYLSRPAIKFILDIVEEQSRSKTGPKAASSKTGPAWASSPDMNAGESGSDFAERIRKILGDR
GASASGSFVTNGDGSCTAIEDLESGISDGFSLQRGYHVRLIAPQIQLQSDKNKKHVVLVTAKGMELKVVEVMDKE
RISDSVSGLVQRRFLVNMDSTQFFVTHQKWFATSLVSMYAGSKYGAPNGSSWPPWVPLEIMFSFTADPFGFKRVV
QKTSAMLRYDKYNNLRLKYNDEVNDGAETASAGSKTEATPETRLDNIWVEFPQARALCNSSQYYAMYVIGLDLLM
YNEPLEKTRSERLEKIMLASDFSDLSGAPQLVQRLQQRIKQLEAIKLHFQTYSAALDRKGWEDRLSLERDLAACE
DELFFVMKAITTSQRKHDASGSDVTALLRWSISAREIVWHLVQDSNEPLVELQLKEVEYDRTDNSDGSHMNLMRV
GKILGLNLLPDATYPEIIAPYHGHDKGSTVDDSDMIRVYWHMLEAIAGIPVMDCFEVTLFPVKIQLERDVGKRLF
DYIFPGMDGDKHASTARSHSLKLEIDDDDDDDANGNNNESDANSHAPTPTAHASPPAGGSSFSTRAGMLELRLKP
TLWSNPPPLPQERSPKKSEHYGRRLLRSAGTGKTMLSKKASHDSLRSSRPGLMRSSTASSTLNESKKSASSRFGL
RHKGGDDEAGAKRGKAQSDDLTKMMTRASSYMTFASIRVPSVVLCLSYKGRDQRNFEDVHDFVFRLPTMEWHNKT
WSNLDLALALKKAVVKALISHTGAIIGNKLSKHRPNAEQRSRLRELASSSAIISAQHLQTITAGGGSSTGTLHDG
ASLDNSDDDSSLYGSWPIDYSRSPPTSSVPHGRAASRGSSAASSNYSLTRSGNAPTGSSRPLSSGNGNGLGIADA
SSHRRLLRAIGSDAKPPPPPPPPLLPGSGSSSAAAAAAATQVSDGSGLALSHSGNSGGHHVSITADGTESTTRRH
GGAGGGFRERISAFAHRRGHHEEEGEGEDRTRSKMLSWAPGRNRAG*
Coding >OphauB2|5771
ATGGCCCTTCTTAACCCCACGTTTCTCCTAGGCCTCGTCGTGCTTGGCTATCTGTCGTCCTTTGTGCTCTTTGCC
ATTCTTCGCATCGTCACAGGCATTTCTATCCAGCGCATTGGCTACCTGTCACTCCGCCGCCTTGCGTATACGCCC
AAAGATGGCCTCAGAGTCGAGATTCGGGGGCTCGGCTTCAGCATACATCGCCCGACATTTGCTCAGCCGACTTGG
ATCAGTCTTGCGCTCGACGAGTTGACCATTACGATTGACGTTGCAGAACTCGAGGGGCTAAAAGCCAAGGACGAC
GAAGACGAGAAGGAGGGGCCTCAACATGGCGTCGACGACGTGACTGGAGCGGAAGCCAAAACGGCACCCTTGCTG
CCAGCTACGCCTTTGCCCAAGGAGCGAGCCTCGAATGGCCACACACATGGCACAGCAGCTCCCGGCGAGACGTGG
AAAAAACTGGCCGATTTCAAGGAGAAACTCAAGCGGTTGCATGGCAAGATTGACTGGATTCGCATGGTGGATGTC
GTTGCGACTGGGTCCACCATCAACGTTGTCGGTGTAGGCAATGTGCAGATTGGCAGCTGCACGCTGGCTGTTGAC
ACGCGGAACAAGATAGTGGACCGGGCCCGTTTCTTCTTCCAGAGGTCCAAGTCGCGCCAGCAGCGGCACCAACAG
GCCGAGTGGATCATGACGTTGCGAAGCGTCCTCTTCACTGCCGACGGCAACGAGTCGCTCGAGGTTCTCGACCAC
GCCCTTTTCAATGTCCACGGCTTTCTCTACCAGTCCAAACAAGGCTTGCTCGATGCCACAATTGCGCTCAAGCTT
GGCAGAGTCCATGTGCCCTATGATGACATTCAGACTTGCTTGGAAAAGCTTGCTCGATGCCGCCACCAGGCGGTC
CATCCCCCCGCGGAGCAGGACGAGCCCCTCGACGGATATGTTGACCAGCTGGCGCAAGAGTTTCAGAATCCTGGT
AGCACCAGTGACGATCTTATGAAGACGGTGTCGGATTCCAAGGACTTCTTCAGCTCCATCCTGGGCGGCATCAAG
GAGATTCAGTTTGCCGTTAGCTTCGTCGGCTTCTCAACCAGAGTCACGTCGATCCATCCAGCAACAAATGCCATT
GTGCTCAATGCCGCCATGAAGGAGGTTGGCTTTGACCTGCACCGGCTGGACCCCAAGTCGCCTGCGCATCGCATG
TACTTTTCCTCAAAGGACATTGCCCACGAGGCTCTGGCTGCCGCCCTGTCCATATCGGTTGGCCTCGACGATGGC
ACGGGCCGGCCGGAGCGGCTCGTCTATATTCCCATGGCCACGACGACGGTTCGCACCACGCTGCCCTCCAAGACG
GTGCAGCTGGCACACAGCGGCAACCTGGAGGAGAAGAATGCAAACATTCTCTTTTCCAACTCGGTCGTCACTTCG
CCCTCGGTCGACTTGAATCCACGTCACCTGCCTCTGCTCATTGCTCTCATGCGGCCCAAGCCCAAGGCTCCCCAG
CCCAGACACAGTGCTAGCAGCCACCTCATCTCGCGCCTCTTGCCCAAGGCCAACATTAAGTTTTCCATGCACGAA
CCCGTCATGCGCATCAAGCTCCAGCCGATGCAGGAATTGCAGGACCCTGACGACTATGACCTCATCATCTCGTCA
ATATCGTCCGTCTCGCTCGATGTTGAATCGTCTCCCTCGTCGGTGCAAGACTTGCACTACTTTCTCGATGGATCC
ATGAGGCTGCAGTCGCATCGCCTCTACTACCAAACCTGCACCAATGACATCTTCAACCTCATTACAACCGAGTCG
TGCGACATCAAGGCCAACCTGGCCGCCGAGCCCGATGTGTGCGTGGACGTGACGAGCAGCATGCAGTGCTTTTCC
ATTAGTATGGCGCGGCCCGAGATTACGCACGGACTGCGGCAAATCGTGCAGCAGCTGCGCATCAATGTGGAACCA
GACAAGCGAAGCAGTTCCAAGTCGCACAAACACCGCACCTTTTTGCGAAGCGCCCCCTCGTGGCTCAAGCGAAGC
CGGTTTGAAGCCTCAGACTTCAATGTCGAGGTGGCGGGCATCGACGAGGAGATTTCGGACGAGACACGCGGCGTC
TCGTTGCATCTCGACAGCTTCACAGCCGAGTATCGAGCCCGACAGCTTGGCGGACCTGAGCGATGGACGCCGAGA
AGACGGACTCACAGTCGATGCATCAACCCATGCGACTCGGAGCCAGCCACACCAGCATCCCCAAGCTTGAAGAAG
AAGACGAAGAACCATGGCGACGGCCGGCTGCTGACGATGCATGCCCGAGGCCTCGAGGCCCAAGTTGTCGAGTCT
GTAGACCGGGTCGAGACTGAGCCGTTTTTGAGGCTACCGCGCCTCGAGCTCACCATGATTGCCCGGTCTGATCGG
ACTGGCCCCGTTTTTGAAATCATATCCGTCATCAAGACCATATCCTTCAACTACTCACTCTACCGCCACTATGCC
ATTGGCGTGGCGGGCATGACGTTGCGCAAAGCATTCATGATGACGGCCCGCGACAATCCTCGGCCACAGCAGCAG
CACCATGGGGAGCAAGACGAACACCTGAGCCCGGGCCACCACGGGTCTGCTGGTGACTCGAGTAGCACCTTGTCA
GTTTCGGATGAGCTCGTGTCGGTCAGTGTCAAGGCCTTTTTTGTGCAGATCAAGGCGGAGATGCCTCACGAGCCG
CAGATGCTGCTTCACATCCACGACTTGAACGCGTCGCGTGCTCGGTGGTCGGCACCATGCTTTTCGGCCAATCTG
ATTCGCTTCTGCATCGAGCCGCCGCGGATGCGCAATGTGTGGTCGAGGATGCTGAGCATCAAGGGGATGCGGGCT
GAATGGTGCGAGACGCGGCAAAAGACGGCGCGGGGCGACTTGATTGACGACAACATGATCAACATTACGAGCGAC
GCGGTGCGACTGGCCGTTCCGCACGAGGTGGTTGTCAGCCAAATCCAGGACAACTGCGTAAATGTGGTCAAGGCT
GTTGCTCAGCTCCATCACCGCTTCAAGACGGGCACCAATGAATACATTTTGGACAAGAAGCCCGAGGGGCCCAAA
AAGGTGCCCAAGATGCGCATCAGAGCCGAGAATTTCCTGCTGGAACTCGAGGATGGCGCCTTTGAGTGGAAGCTG
GGCATCATTTACCGGGCTGGGCGCATCGAGCAGATTCAAAGGCTGGCTCGCGAGGAGGCATTTTTGTACAAGGCC
AAAAAGGCGAGGGAGCAGGCGCGCAAAGGCCGCTCTCGCTCAATTGCGGCGCGGGGACGCACAGCCCATGGATCG
TCGTCGTCGGCGTGGTTCAGAAGCCACAGCGAAGACGGGCGTGTGGGCGCAGCGCACATGCGGCCTCGCTACGAC
CCCGAGGGCGACAGCATTGGCATCAATGGCAATGCCAAGGTGGGCGAGGAGGAGGCGCGGGCGCGGCTCAATGTC
TTTAATGCGCAGTCGTGGCAGCAGCGCATCAACCTTGCCTACCAAGAGTCTCAGGACCGCGTCAAGGAGCAGCGA
GTGGTTTTCTGGGGCAACGACGAGCTGCCACAAGAGGTGGAGGTGACGGAGAAGATTTTGGCGGTGCCTCCGCGC
CCAGCACTGCTGTCGGCCGTGATGCGGGCGCTCGTGGTGAATATTGACAAGCCCAGCTTTGCCATGCAGAGCCTG
CCCGACTTTATCCACCGCGTGGGCAAGGGCATGCCGCGAGACATGAAGTATGGCTTGCTGGTGCCCATGCACATT
GGCATCACCATGACGGAGGCGCTCATTTCGCTGCGCGACTATCCGCTGCCGCTGCTACACATACCCGGGTTCAAG
GGTAGCCACCGGCCCGGCACTGTGTCGATTCAGGCCAACTTTGTCGTGGCTGAGGAGTTTCGAGGCATGGAGTCG
ACGCGGCGGGTGCTGGTGAATGTGGTGCCGCCGCGGCACACGGGCCCCGACTCGACAAAGCACGGCAGCTTTGCG
ATAGAAGTGCGGCGGACGATTGGGCCCATCAAGTCGTTTTCCGAGGTGGACATGGACATTCACACGGGACTGCCG
ACGCGCATCACGTGGGCGCCCTGCTACCAGCCAGCCATTCAGGACGTCATGATGGTGATTGAGTCGTTTACCAAG
CCGCCGGTGGATCCGTCGGAGCGCGTCGGCTTCTGGGACAAGATCCGGCTGACGATGCACTCGCGGGTGCACGTG
GCCTGGAAGGGCGACGGCGACATGCATCTGGTGCTCAAGGGGTCGCGCGACCCCTATTACGTGACGGGCACGGGG
GCTGGCTTCATCATGTGCTGGCGCAACGAGGTGCGGTGGAACATCAACTGCGAAGACGACCCCAAGCGCTTCATG
ACGGTGGACAGCGGCGAGTTCATTTGGGCGGTGCCCGACTTTAGCTACCTGGTGCGTAGCGCGGCGCAGCGTGAC
GGGCGCTTCCTGGACAGCGGCAGCCGGTCAGGGGCCGCCTTTCAAAAGGTGGTGATGAAGCTGTCGGGCAAGGTG
CAGTGGATGGCGGGCTTGGTCTTTGAGCAGGCCATTGAGGGCGGCAAGAGGAACTTTGACTTTGTGCCGCACTAC
GACGTGGTGCTCAAGCACCCGCACTTTGCCAAGCCCGACGACGACGGGCTGCCCTATGATGCCATGCGAGGCTTC
CGCAGCCGCCATATTCACCTCTCGATTGCGGTGCGCGCCCCTGCCGACCGCGACTGGACGTCGCAGTTTCCCGAG
CCGTCTCGAAGCTACAACACGGTGCACTTTACGCCGCGCTTCTTTACGCACTTTTTCCAGTGGTGGGCGCTCTTT
AGCCAGCAAACCATGCCCATTCGCCAGGGGAGCCTGTTTCCCGCGCGCGAGAAGAATAGCAAAAAGTTTGGCCGC
CACTTGGCCACGGTCAAGTACAGCCTGTTGCTTGCGCCCCTCTTCCTCAGCCACATTTACAAGCACAAGGACGCC
GAGGACTACGCCGAGGATGCCGTGTCTGCCACGGGCCTCAAGGTGCGCTTCGACAGCTGGATGCTGGACCTGCAC
CAGCGGCGAGAAGAGTTCAACACGCTGGGCAAGGGCCGCAATGCCCAGGGCCGCACCTCTGCCATCAAGATCCAC
GCGGCCCAGCTGGATCTGGCCAGCGCCGATGTGCGTGCCGTGTCGGCGAGTATCAAGGGTACCACGACGGAAGCC
ATCAAAAAGGGCTCTCTGGCAGGCCTCGTTGTCGACCAGGACGACAAGCCCGACTTGTCCAAGTTCATCATACCC
GACAATGACTTTAGCTGGATCGACATGGACGACTTTGTCGAGCTCGACTGGATCCTGCCGACGGAGCCGCATCCT
CGCACCAAGATACTGCCGCTGGCATTTGCGCCTCGGCTGACGTACTTTCGGCAGACGGACATTGGCGGCACCATT
GCAGGAGACCCGTCGAGGACAAGCCCGTTTGGCTCAGAGCCGACGCACTTTTGCATCACGTCGTACGACGACGAT
CCCAAGCGCGTGCAAGGCGAGCTGGTGCAGGAGCGGCTCGACCAGCTCGAGGACCAGATGCTGCAGCACTCGAGA
GACGTGGGCGATGCAGAGCTCAAGGTGATTCAGATGAATGCGCAAGACGGCGAGCTCGTGGCCAACCTGGAGGCG
CTGCGCAAGCACTCGGGCGTCTTGAAGGACAAGAAGATATTCTTGGAAAACATGCTGGAGCAGATTCAAGGCGAC
GGGGGCCGGCGGTCGTCGCTGGCGCCGGGCGATGGCCAAGAGACGCTCGACTTGCCGTCGGCAGCGCGGTTTGAG
AGCGAGTTTACCAACCGCTTCGTCATTCATAACATGCAGCTCAAGTGGAACAATATGCTGCGCAACATTGTGCTG
CGCTACATTCACCAGAATAGCCAGCGGCGCGGCTTTGTCTACTACCTGTCGCGGCCAGCCATCAAGTTTATCCTG
GACATTGTGGAGGAGCAGAGCCGGAGCAAGACGGGCCCCAAGGCGGCATCCAGCAAGACGGGGCCAGCCTGGGCC
TCGTCGCCCGACATGAATGCGGGGGAGAGCGGAAGCGACTTTGCAGAGCGCATCCGCAAGATTCTGGGGGACCGC
GGGGCGTCGGCGAGCGGCAGCTTTGTGACGAATGGCGACGGCAGCTGCACGGCGATTGAGGATCTGGAGAGCGGC
ATCTCGGACGGCTTCAGCCTGCAGCGCGGCTACCACGTGCGGCTGATTGCGCCGCAGATCCAGCTGCAGAGCGAC
AAGAACAAGAAGCACGTGGTGCTGGTGACGGCCAAGGGCATGGAGCTCAAGGTGGTGGAGGTGATGGACAAGGAG
CGCATCTCGGACTCGGTGAGCGGGCTGGTGCAGCGGCGCTTCCTGGTCAACATGGACAGCACGCAGTTCTTTGTG
ACGCACCAAAAGTGGTTTGCCACGAGCCTCGTGTCCATGTATGCAGGCAGCAAGTACGGGGCGCCCAACGGGTCG
TCGTGGCCGCCGTGGGTGCCGCTGGAAATCATGTTTAGCTTCACGGCGGACCCGTTTGGCTTCAAGCGCGTGGTG
CAAAAGACATCGGCCATGCTGCGCTACGACAAGTACAACAATTTGCGGCTCAAGTACAATGACGAGGTGAATGAC
GGGGCCGAGACGGCGAGCGCGGGCAGCAAGACGGAGGCGACGCCCGAGACGCGGCTCGACAACATTTGGGTCGAG
TTCCCGCAGGCGCGGGCGCTGTGCAACTCGTCGCAGTACTATGCCATGTACGTGATTGGGCTGGACCTGCTCATG
TACAATGAGCCGCTGGAGAAGACGCGCAGCGAGCGGCTCGAGAAGATTATGCTGGCGTCCGACTTTAGCGACCTG
AGCGGCGCGCCGCAACTGGTGCAGCGGCTGCAGCAGCGCATCAAGCAGCTCGAGGCCATCAAGCTGCACTTCCAG
ACCTACTCGGCCGCCCTGGACCGCAAGGGCTGGGAGGACCGCCTGTCGCTGGAGCGCGACTTGGCGGCGTGCGAG
GACGAGCTCTTTTTTGTCATGAAGGCCATTACCACGTCGCAGCGCAAGCACGACGCCAGCGGCAGCGACGTGACG
GCCCTGCTGCGGTGGAGCATTTCGGCCCGCGAGATTGTCTGGCACCTGGTGCAGGACTCCAACGAGCCGCTGGTG
GAGCTGCAGCTCAAGGAGGTTGAGTATGACCGCACCGACAACTCGGACGGCTCCCACATGAACCTGATGCGCGTC
GGCAAGATTCTCGGCCTCAACCTGCTGCCCGACGCCACCTACCCCGAGATTATTGCGCCCTACCACGGCCACGAC
AAGGGGTCCACGGTGGACGACAGCGACATGATTCGCGTCTACTGGCACATGCTCGAGGCCATTGCCGGCATCCCC
GTCATGGACTGCTTCGAGGTGACGCTCTTCCCCGTCAAGATTCAGCTGGAGCGCGACGTGGGAAAGCGCCTCTTT
GACTACATCTTTCCCGGCATGGACGGCGACAAGCACGCGTCGACGGCGCGCAGCCACTCGCTCAAGCTTGAGATT
GACGATGACGACGATGACGACGCCAATGGCAACAACAATGAGAGCGACGCAAATAGCCACGCGCCAACGCCCACG
GCACACGCCAGCCCCCCCGCCGGCGGCAGCAGCTTCTCAACGCGGGCCGGCATGCTGGAGCTGCGGCTTAAACCA
ACACTGTGGTCGAATCCGCCGCCGCTGCCGCAGGAGCGCAGCCCCAAGAAGAGCGAGCACTATGGCAGGCGCCTG
CTGCGCTCGGCCGGCACGGGCAAGACGATGCTGTCGAAAAAGGCATCGCACGACTCGCTGCGCAGCTCGCGGCCC
GGGCTGATGCGATCGTCAACGGCCAGCAGCACGCTCAACGAGAGCAAGAAGAGCGCCTCGTCGCGCTTTGGCCTG
CGCCACAAGGGCGGCGACGACGAGGCCGGGGCCAAGCGCGGCAAGGCGCAGTCGGACGACTTGACCAAGATGATG
ACGCGCGCCAGCAGCTACATGACGTTTGCCTCGATTCGCGTGCCGTCGGTGGTGCTGTGCCTGAGCTACAAGGGC
CGCGACCAGCGCAACTTTGAAGACGTGCACGACTTTGTCTTTCGCCTGCCCACCATGGAGTGGCACAACAAGACG
TGGTCCAACCTGGACCTGGCGCTGGCGCTCAAAAAGGCGGTTGTCAAGGCGCTCATTTCCCACACGGGCGCCATT
ATCGGCAACAAGCTGTCCAAGCACCGGCCCAATGCCGAGCAGCGCAGCAGACTGCGCGAGCTGGCCAGCAGCTCC
GCCATCATCTCGGCGCAGCATCTGCAGACCATTACCGCTGGCGGAGGAAGCAGCACCGGCACTCTGCACGACGGG
GCCAGTCTGGACAATAGTGACGACGACTCGAGCCTCTATGGGAGCTGGCCCATTGACTACTCGCGCTCGCCGCCC
ACGAGCAGCGTGCCGCATGGCCGTGCCGCAAGCCGGGGCAGCAGCGCTGCTAGTAGCAACTACTCGCTGACTCGG
TCCGGCAACGCGCCCACTGGCTCGTCGCGGCCGCTGTCGAGCGGCAACGGCAACGGCTTGGGCATTGCAGACGCG
TCGTCGCACCGGCGTCTGCTGCGCGCCATTGGCTCCGATGCCAAGCCTCCTCCTCCTCCTCCTCCTCCGCTGCTG
CCTGGTAGTGGTAGTAGTAGTGCTGCTGCTGCTGCTGCTGCTACACAAGTGTCAGACGGCTCCGGGCTGGCCTTG
AGCCACAGCGGCAACTCGGGCGGCCACCATGTGTCGATTACGGCCGATGGGACCGAGTCGACGACGCGGCGGCAC
GGCGGCGCTGGCGGGGGCTTCCGAGAGCGCATTAGTGCGTTTGCGCATCGGCGGGGGCACCATGAGGAAGAGGGC
GAGGGGGAGGATAGGACGAGGAGCAAGATGCTTAGCTGGGCGCCAGGGAGGAACCGCGCAGGCTAG
Transcript >OphauB2|5771
ATGGCCCTTCTTAACCCCACGTTTCTCCTAGGCCTCGTCGTGCTTGGCTATCTGTCGTCCTTTGTGCTCTTTGCC
ATTCTTCGCATCGTCACAGGCATTTCTATCCAGCGCATTGGCTACCTGTCACTCCGCCGCCTTGCGTATACGCCC
AAAGATGGCCTCAGAGTCGAGATTCGGGGGCTCGGCTTCAGCATACATCGCCCGACATTTGCTCAGCCGACTTGG
ATCAGTCTTGCGCTCGACGAGTTGACCATTACGATTGACGTTGCAGAACTCGAGGGGCTAAAAGCCAAGGACGAC
GAAGACGAGAAGGAGGGGCCTCAACATGGCGTCGACGACGTGACTGGAGCGGAAGCCAAAACGGCACCCTTGCTG
CCAGCTACGCCTTTGCCCAAGGAGCGAGCCTCGAATGGCCACACACATGGCACAGCAGCTCCCGGCGAGACGTGG
AAAAAACTGGCCGATTTCAAGGAGAAACTCAAGCGGTTGCATGGCAAGATTGACTGGATTCGCATGGTGGATGTC
GTTGCGACTGGGTCCACCATCAACGTTGTCGGTGTAGGCAATGTGCAGATTGGCAGCTGCACGCTGGCTGTTGAC
ACGCGGAACAAGATAGTGGACCGGGCCCGTTTCTTCTTCCAGAGGTCCAAGTCGCGCCAGCAGCGGCACCAACAG
GCCGAGTGGATCATGACGTTGCGAAGCGTCCTCTTCACTGCCGACGGCAACGAGTCGCTCGAGGTTCTCGACCAC
GCCCTTTTCAATGTCCACGGCTTTCTCTACCAGTCCAAACAAGGCTTGCTCGATGCCACAATTGCGCTCAAGCTT
GGCAGAGTCCATGTGCCCTATGATGACATTCAGACTTGCTTGGAAAAGCTTGCTCGATGCCGCCACCAGGCGGTC
CATCCCCCCGCGGAGCAGGACGAGCCCCTCGACGGATATGTTGACCAGCTGGCGCAAGAGTTTCAGAATCCTGGT
AGCACCAGTGACGATCTTATGAAGACGGTGTCGGATTCCAAGGACTTCTTCAGCTCCATCCTGGGCGGCATCAAG
GAGATTCAGTTTGCCGTTAGCTTCGTCGGCTTCTCAACCAGAGTCACGTCGATCCATCCAGCAACAAATGCCATT
GTGCTCAATGCCGCCATGAAGGAGGTTGGCTTTGACCTGCACCGGCTGGACCCCAAGTCGCCTGCGCATCGCATG
TACTTTTCCTCAAAGGACATTGCCCACGAGGCTCTGGCTGCCGCCCTGTCCATATCGGTTGGCCTCGACGATGGC
ACGGGCCGGCCGGAGCGGCTCGTCTATATTCCCATGGCCACGACGACGGTTCGCACCACGCTGCCCTCCAAGACG
GTGCAGCTGGCACACAGCGGCAACCTGGAGGAGAAGAATGCAAACATTCTCTTTTCCAACTCGGTCGTCACTTCG
CCCTCGGTCGACTTGAATCCACGTCACCTGCCTCTGCTCATTGCTCTCATGCGGCCCAAGCCCAAGGCTCCCCAG
CCCAGACACAGTGCTAGCAGCCACCTCATCTCGCGCCTCTTGCCCAAGGCCAACATTAAGTTTTCCATGCACGAA
CCCGTCATGCGCATCAAGCTCCAGCCGATGCAGGAATTGCAGGACCCTGACGACTATGACCTCATCATCTCGTCA
ATATCGTCCGTCTCGCTCGATGTTGAATCGTCTCCCTCGTCGGTGCAAGACTTGCACTACTTTCTCGATGGATCC
ATGAGGCTGCAGTCGCATCGCCTCTACTACCAAACCTGCACCAATGACATCTTCAACCTCATTACAACCGAGTCG
TGCGACATCAAGGCCAACCTGGCCGCCGAGCCCGATGTGTGCGTGGACGTGACGAGCAGCATGCAGTGCTTTTCC
ATTAGTATGGCGCGGCCCGAGATTACGCACGGACTGCGGCAAATCGTGCAGCAGCTGCGCATCAATGTGGAACCA
GACAAGCGAAGCAGTTCCAAGTCGCACAAACACCGCACCTTTTTGCGAAGCGCCCCCTCGTGGCTCAAGCGAAGC
CGGTTTGAAGCCTCAGACTTCAATGTCGAGGTGGCGGGCATCGACGAGGAGATTTCGGACGAGACACGCGGCGTC
TCGTTGCATCTCGACAGCTTCACAGCCGAGTATCGAGCCCGACAGCTTGGCGGACCTGAGCGATGGACGCCGAGA
AGACGGACTCACAGTCGATGCATCAACCCATGCGACTCGGAGCCAGCCACACCAGCATCCCCAAGCTTGAAGAAG
AAGACGAAGAACCATGGCGACGGCCGGCTGCTGACGATGCATGCCCGAGGCCTCGAGGCCCAAGTTGTCGAGTCT
GTAGACCGGGTCGAGACTGAGCCGTTTTTGAGGCTACCGCGCCTCGAGCTCACCATGATTGCCCGGTCTGATCGG
ACTGGCCCCGTTTTTGAAATCATATCCGTCATCAAGACCATATCCTTCAACTACTCACTCTACCGCCACTATGCC
ATTGGCGTGGCGGGCATGACGTTGCGCAAAGCATTCATGATGACGGCCCGCGACAATCCTCGGCCACAGCAGCAG
CACCATGGGGAGCAAGACGAACACCTGAGCCCGGGCCACCACGGGTCTGCTGGTGACTCGAGTAGCACCTTGTCA
GTTTCGGATGAGCTCGTGTCGGTCAGTGTCAAGGCCTTTTTTGTGCAGATCAAGGCGGAGATGCCTCACGAGCCG
CAGATGCTGCTTCACATCCACGACTTGAACGCGTCGCGTGCTCGGTGGTCGGCACCATGCTTTTCGGCCAATCTG
ATTCGCTTCTGCATCGAGCCGCCGCGGATGCGCAATGTGTGGTCGAGGATGCTGAGCATCAAGGGGATGCGGGCT
GAATGGTGCGAGACGCGGCAAAAGACGGCGCGGGGCGACTTGATTGACGACAACATGATCAACATTACGAGCGAC
GCGGTGCGACTGGCCGTTCCGCACGAGGTGGTTGTCAGCCAAATCCAGGACAACTGCGTAAATGTGGTCAAGGCT
GTTGCTCAGCTCCATCACCGCTTCAAGACGGGCACCAATGAATACATTTTGGACAAGAAGCCCGAGGGGCCCAAA
AAGGTGCCCAAGATGCGCATCAGAGCCGAGAATTTCCTGCTGGAACTCGAGGATGGCGCCTTTGAGTGGAAGCTG
GGCATCATTTACCGGGCTGGGCGCATCGAGCAGATTCAAAGGCTGGCTCGCGAGGAGGCATTTTTGTACAAGGCC
AAAAAGGCGAGGGAGCAGGCGCGCAAAGGCCGCTCTCGCTCAATTGCGGCGCGGGGACGCACAGCCCATGGATCG
TCGTCGTCGGCGTGGTTCAGAAGCCACAGCGAAGACGGGCGTGTGGGCGCAGCGCACATGCGGCCTCGCTACGAC
CCCGAGGGCGACAGCATTGGCATCAATGGCAATGCCAAGGTGGGCGAGGAGGAGGCGCGGGCGCGGCTCAATGTC
TTTAATGCGCAGTCGTGGCAGCAGCGCATCAACCTTGCCTACCAAGAGTCTCAGGACCGCGTCAAGGAGCAGCGA
GTGGTTTTCTGGGGCAACGACGAGCTGCCACAAGAGGTGGAGGTGACGGAGAAGATTTTGGCGGTGCCTCCGCGC
CCAGCACTGCTGTCGGCCGTGATGCGGGCGCTCGTGGTGAATATTGACAAGCCCAGCTTTGCCATGCAGAGCCTG
CCCGACTTTATCCACCGCGTGGGCAAGGGCATGCCGCGAGACATGAAGTATGGCTTGCTGGTGCCCATGCACATT
GGCATCACCATGACGGAGGCGCTCATTTCGCTGCGCGACTATCCGCTGCCGCTGCTACACATACCCGGGTTCAAG
GGTAGCCACCGGCCCGGCACTGTGTCGATTCAGGCCAACTTTGTCGTGGCTGAGGAGTTTCGAGGCATGGAGTCG
ACGCGGCGGGTGCTGGTGAATGTGGTGCCGCCGCGGCACACGGGCCCCGACTCGACAAAGCACGGCAGCTTTGCG
ATAGAAGTGCGGCGGACGATTGGGCCCATCAAGTCGTTTTCCGAGGTGGACATGGACATTCACACGGGACTGCCG
ACGCGCATCACGTGGGCGCCCTGCTACCAGCCAGCCATTCAGGACGTCATGATGGTGATTGAGTCGTTTACCAAG
CCGCCGGTGGATCCGTCGGAGCGCGTCGGCTTCTGGGACAAGATCCGGCTGACGATGCACTCGCGGGTGCACGTG
GCCTGGAAGGGCGACGGCGACATGCATCTGGTGCTCAAGGGGTCGCGCGACCCCTATTACGTGACGGGCACGGGG
GCTGGCTTCATCATGTGCTGGCGCAACGAGGTGCGGTGGAACATCAACTGCGAAGACGACCCCAAGCGCTTCATG
ACGGTGGACAGCGGCGAGTTCATTTGGGCGGTGCCCGACTTTAGCTACCTGGTGCGTAGCGCGGCGCAGCGTGAC
GGGCGCTTCCTGGACAGCGGCAGCCGGTCAGGGGCCGCCTTTCAAAAGGTGGTGATGAAGCTGTCGGGCAAGGTG
CAGTGGATGGCGGGCTTGGTCTTTGAGCAGGCCATTGAGGGCGGCAAGAGGAACTTTGACTTTGTGCCGCACTAC
GACGTGGTGCTCAAGCACCCGCACTTTGCCAAGCCCGACGACGACGGGCTGCCCTATGATGCCATGCGAGGCTTC
CGCAGCCGCCATATTCACCTCTCGATTGCGGTGCGCGCCCCTGCCGACCGCGACTGGACGTCGCAGTTTCCCGAG
CCGTCTCGAAGCTACAACACGGTGCACTTTACGCCGCGCTTCTTTACGCACTTTTTCCAGTGGTGGGCGCTCTTT
AGCCAGCAAACCATGCCCATTCGCCAGGGGAGCCTGTTTCCCGCGCGCGAGAAGAATAGCAAAAAGTTTGGCCGC
CACTTGGCCACGGTCAAGTACAGCCTGTTGCTTGCGCCCCTCTTCCTCAGCCACATTTACAAGCACAAGGACGCC
GAGGACTACGCCGAGGATGCCGTGTCTGCCACGGGCCTCAAGGTGCGCTTCGACAGCTGGATGCTGGACCTGCAC
CAGCGGCGAGAAGAGTTCAACACGCTGGGCAAGGGCCGCAATGCCCAGGGCCGCACCTCTGCCATCAAGATCCAC
GCGGCCCAGCTGGATCTGGCCAGCGCCGATGTGCGTGCCGTGTCGGCGAGTATCAAGGGTACCACGACGGAAGCC
ATCAAAAAGGGCTCTCTGGCAGGCCTCGTTGTCGACCAGGACGACAAGCCCGACTTGTCCAAGTTCATCATACCC
GACAATGACTTTAGCTGGATCGACATGGACGACTTTGTCGAGCTCGACTGGATCCTGCCGACGGAGCCGCATCCT
CGCACCAAGATACTGCCGCTGGCATTTGCGCCTCGGCTGACGTACTTTCGGCAGACGGACATTGGCGGCACCATT
GCAGGAGACCCGTCGAGGACAAGCCCGTTTGGCTCAGAGCCGACGCACTTTTGCATCACGTCGTACGACGACGAT
CCCAAGCGCGTGCAAGGCGAGCTGGTGCAGGAGCGGCTCGACCAGCTCGAGGACCAGATGCTGCAGCACTCGAGA
GACGTGGGCGATGCAGAGCTCAAGGTGATTCAGATGAATGCGCAAGACGGCGAGCTCGTGGCCAACCTGGAGGCG
CTGCGCAAGCACTCGGGCGTCTTGAAGGACAAGAAGATATTCTTGGAAAACATGCTGGAGCAGATTCAAGGCGAC
GGGGGCCGGCGGTCGTCGCTGGCGCCGGGCGATGGCCAAGAGACGCTCGACTTGCCGTCGGCAGCGCGGTTTGAG
AGCGAGTTTACCAACCGCTTCGTCATTCATAACATGCAGCTCAAGTGGAACAATATGCTGCGCAACATTGTGCTG
CGCTACATTCACCAGAATAGCCAGCGGCGCGGCTTTGTCTACTACCTGTCGCGGCCAGCCATCAAGTTTATCCTG
GACATTGTGGAGGAGCAGAGCCGGAGCAAGACGGGCCCCAAGGCGGCATCCAGCAAGACGGGGCCAGCCTGGGCC
TCGTCGCCCGACATGAATGCGGGGGAGAGCGGAAGCGACTTTGCAGAGCGCATCCGCAAGATTCTGGGGGACCGC
GGGGCGTCGGCGAGCGGCAGCTTTGTGACGAATGGCGACGGCAGCTGCACGGCGATTGAGGATCTGGAGAGCGGC
ATCTCGGACGGCTTCAGCCTGCAGCGCGGCTACCACGTGCGGCTGATTGCGCCGCAGATCCAGCTGCAGAGCGAC
AAGAACAAGAAGCACGTGGTGCTGGTGACGGCCAAGGGCATGGAGCTCAAGGTGGTGGAGGTGATGGACAAGGAG
CGCATCTCGGACTCGGTGAGCGGGCTGGTGCAGCGGCGCTTCCTGGTCAACATGGACAGCACGCAGTTCTTTGTG
ACGCACCAAAAGTGGTTTGCCACGAGCCTCGTGTCCATGTATGCAGGCAGCAAGTACGGGGCGCCCAACGGGTCG
TCGTGGCCGCCGTGGGTGCCGCTGGAAATCATGTTTAGCTTCACGGCGGACCCGTTTGGCTTCAAGCGCGTGGTG
CAAAAGACATCGGCCATGCTGCGCTACGACAAGTACAACAATTTGCGGCTCAAGTACAATGACGAGGTGAATGAC
GGGGCCGAGACGGCGAGCGCGGGCAGCAAGACGGAGGCGACGCCCGAGACGCGGCTCGACAACATTTGGGTCGAG
TTCCCGCAGGCGCGGGCGCTGTGCAACTCGTCGCAGTACTATGCCATGTACGTGATTGGGCTGGACCTGCTCATG
TACAATGAGCCGCTGGAGAAGACGCGCAGCGAGCGGCTCGAGAAGATTATGCTGGCGTCCGACTTTAGCGACCTG
AGCGGCGCGCCGCAACTGGTGCAGCGGCTGCAGCAGCGCATCAAGCAGCTCGAGGCCATCAAGCTGCACTTCCAG
ACCTACTCGGCCGCCCTGGACCGCAAGGGCTGGGAGGACCGCCTGTCGCTGGAGCGCGACTTGGCGGCGTGCGAG
GACGAGCTCTTTTTTGTCATGAAGGCCATTACCACGTCGCAGCGCAAGCACGACGCCAGCGGCAGCGACGTGACG
GCCCTGCTGCGGTGGAGCATTTCGGCCCGCGAGATTGTCTGGCACCTGGTGCAGGACTCCAACGAGCCGCTGGTG
GAGCTGCAGCTCAAGGAGGTTGAGTATGACCGCACCGACAACTCGGACGGCTCCCACATGAACCTGATGCGCGTC
GGCAAGATTCTCGGCCTCAACCTGCTGCCCGACGCCACCTACCCCGAGATTATTGCGCCCTACCACGGCCACGAC
AAGGGGTCCACGGTGGACGACAGCGACATGATTCGCGTCTACTGGCACATGCTCGAGGCCATTGCCGGCATCCCC
GTCATGGACTGCTTCGAGGTGACGCTCTTCCCCGTCAAGATTCAGCTGGAGCGCGACGTGGGAAAGCGCCTCTTT
GACTACATCTTTCCCGGCATGGACGGCGACAAGCACGCGTCGACGGCGCGCAGCCACTCGCTCAAGCTTGAGATT
GACGATGACGACGATGACGACGCCAATGGCAACAACAATGAGAGCGACGCAAATAGCCACGCGCCAACGCCCACG
GCACACGCCAGCCCCCCCGCCGGCGGCAGCAGCTTCTCAACGCGGGCCGGCATGCTGGAGCTGCGGCTTAAACCA
ACACTGTGGTCGAATCCGCCGCCGCTGCCGCAGGAGCGCAGCCCCAAGAAGAGCGAGCACTATGGCAGGCGCCTG
CTGCGCTCGGCCGGCACGGGCAAGACGATGCTGTCGAAAAAGGCATCGCACGACTCGCTGCGCAGCTCGCGGCCC
GGGCTGATGCGATCGTCAACGGCCAGCAGCACGCTCAACGAGAGCAAGAAGAGCGCCTCGTCGCGCTTTGGCCTG
CGCCACAAGGGCGGCGACGACGAGGCCGGGGCCAAGCGCGGCAAGGCGCAGTCGGACGACTTGACCAAGATGATG
ACGCGCGCCAGCAGCTACATGACGTTTGCCTCGATTCGCGTGCCGTCGGTGGTGCTGTGCCTGAGCTACAAGGGC
CGCGACCAGCGCAACTTTGAAGACGTGCACGACTTTGTCTTTCGCCTGCCCACCATGGAGTGGCACAACAAGACG
TGGTCCAACCTGGACCTGGCGCTGGCGCTCAAAAAGGCGGTTGTCAAGGCGCTCATTTCCCACACGGGCGCCATT
ATCGGCAACAAGCTGTCCAAGCACCGGCCCAATGCCGAGCAGCGCAGCAGACTGCGCGAGCTGGCCAGCAGCTCC
GCCATCATCTCGGCGCAGCATCTGCAGACCATTACCGCTGGCGGAGGAAGCAGCACCGGCACTCTGCACGACGGG
GCCAGTCTGGACAATAGTGACGACGACTCGAGCCTCTATGGGAGCTGGCCCATTGACTACTCGCGCTCGCCGCCC
ACGAGCAGCGTGCCGCATGGCCGTGCCGCAAGCCGGGGCAGCAGCGCTGCTAGTAGCAACTACTCGCTGACTCGG
TCCGGCAACGCGCCCACTGGCTCGTCGCGGCCGCTGTCGAGCGGCAACGGCAACGGCTTGGGCATTGCAGACGCG
TCGTCGCACCGGCGTCTGCTGCGCGCCATTGGCTCCGATGCCAAGCCTCCTCCTCCTCCTCCTCCTCCGCTGCTG
CCTGGTAGTGGTAGTAGTAGTGCTGCTGCTGCTGCTGCTGCTACACAAGTGTCAGACGGCTCCGGGCTGGCCTTG
AGCCACAGCGGCAACTCGGGCGGCCACCATGTGTCGATTACGGCCGATGGGACCGAGTCGACGACGCGGCGGCAC
GGCGGCGCTGGCGGGGGCTTCCGAGAGCGCATTAGTGCGTTTGCGCATCGGCGGGGGCACCATGAGGAAGAGGGC
GAGGGGGAGGATAGGACGAGGAGCAAGATGCTTAGCTGGGCGCCAGGGAGGAACCGCGCAGGCTAG
Gene >OphauB2|5771
ATGGCCCTTCTTAACCCCACGTTTCTCCTAGGCCTCGTCGTGCTTGGCTATCTGTCGTCCTTTGTGCTCTTTGCC
ATTCTTCGCATCGTCACAGGCATTTCTATCCAGCGCATTGGCTACCTGTCACTCCGCCGCCTTGCGTATACGCCC
AAAGATGGCCTCAGAGTCGAGATTCGGGGGCTCGGCTTCAGCATACATCGCCCGACATTTGCTCAGCCGACTTGG
ATCAGTCTTGCGCTCGACGAGTTGACCATTACGATTGACGTTGCAGAACTCGAGGGGCTAAAAGCCAAGGACGAC
GAAGACGAGAAGGAGGGGCCTCAACATGGCGTCGACGACGTGACTGGAGCGGAAGCCAAAACGGCACCCTTGCTG
CCAGCTACGCCTTTGCCCAAGGAGCGAGCCTCGAATGGCCACACACATGGCACAGCAGCTCCCGGCGAGACGTGG
AAAAAACTGGCCGATTTCAAGGAGAAACTCAAGCGGTTGCATGGCAAGATTGACTGGATTCGCATGGTGGATGTC
GTTGCGACTGGGTCCACCATCAACGTTGTCGGTGTAGGCAATGTGCAGATTGGCAGCTGCACGCTGGCTGTTGAC
ACGCGGAACAAGATAGTGGACCGGGCCCGTTTCTTCTTCCAGAGGTCCAAGTCGCGCCAGCAGCGGCACCAACAG
GCCGAGTGGATCATGACGTTGCGAAGCGTCCTCTTCACTGCCGACGGCAACGAGTCGCTCGAGGTTCTCGACCAC
GCCCTTTTCAATGTCCACGGCTTTCTCTACCAGTCCAAACAAGGCTTGCTCGATGCCACAATTGCGCTCAAGCTT
GGCAGAGTCCATGTGCCCTATGATGACATTCAGACTTGCTTGGAAAAGCTTGCTCGATGCCGCCACCAGGCGGTC
CATCCCCCCGCGGAGCAGGACGAGCCCCTCGACGGATATGTTGACCAGCTGGCGCAAGAGTTTCAGAATCCTGGT
AGCACCAGTGACGATCTTATGAAGACGGTGTCGGATTCCAAGGACTTCTTCAGCTCCATCCTGGGCGGCATCAAG
GAGATTCAGTTTGCCGTTAGCTTCGTCGGCTTCTCAACCAGAGTCACGTCGATCCATCCAGCAACAAATGCCATT
GTGCTCAATGCCGCCATGAAGGAGGTTGGCTTTGACCTGCACCGGCTGGACCCCAAGTCGCCTGCGCATCGCATG
TACTTTTCCTCAAAGGACATTGCCCACGAGGCTCTGGCTGCCGCCCTGTCCATATCGGTTGGCCTCGACGATGGC
ACGGGCCGGCCGGAGCGGCTCGTCTATATTCCCATGGCCACGACGACGGTTCGCACCACGCTGCCCTCCAAGACG
GTGCAGCTGGCACACAGCGGCAACCTGGAGGAGAAGAATGCAAACATTCTCTTTTCCAACTCGGTCGTCACTTCG
CCCTCGGTCGACTTGAATCCACGTCACCTGCCTCTGCTCATTGCTCTCATGCGGCCCAAGCCCAAGGCTCCCCAG
CCCAGACACAGTGCTAGCAGCCACCTCATCTCGCGCCTCTTGCCCAAGGCCAACATTAAGTTTTCCATGCACGAA
CCCGTCATGCGCATCAAGCTCCAGCCGATGCAGGAATTGCAGGACCCTGACGACTATGACCTCATCATCTCGTCA
ATATCGTCCGTCTCGCTCGATGTTGAATCGTCTCCCTCGTCGGTGCAAGACTTGCACTACTTTCTCGATGGATCC
ATGAGGCTGCAGTCGCATCGCCTCTACTACCAAACCTGCACCAATGACATCTTCAACCTCATTACAACCGAGTCG
TGCGACATCAAGGCCAACCTGGCCGCCGAGCCCGATGTGTGCGTGGACGTGACGAGCAGCATGCAGTGCTTTTCC
ATTAGTATGGCGCGGCCCGAGATTACGCACGGACTGCGGCAAATCGTGCAGCAGCTGCGCATCAATGTGGAACCA
GACAAGCGAAGCAGTTCCAAGTCGCACAAACACCGCACCTTTTTGCGAAGCGCCCCCTCGTGGCTCAAGCGAAGC
CGGTTTGAAGCCTCAGACTTCAATGTCGAGGTGGCGGGCATCGACGAGGAGATTTCGGACGAGACACGCGGCGTC
TCGTTGCATCTCGACAGCTTCACAGCCGAGTATCGAGCCCGACAGCTTGGCGGACCTGAGCGATGGACGCCGAGA
AGACGGACTCACAGTCGATGCATCAACCCATGCGACTCGGAGCCAGCCACACCAGCATCCCCAAGCTTGAAGAAG
AAGACGAAGAACCATGGCGACGGCCGGCTGCTGACGATGCATGCCCGAGGCCTCGAGGCCCAAGTTGTCGAGTCT
GTAGACCGGGTCGAGACTGAGCCGTTTTTGAGGCTACCGCGCCTCGAGCTCACCATGATTGCCCGGTCTGATCGG
ACTGGCCCCGTTTTTGAAATCATATCCGTCATCAAGACCATATCCTTCAACTACTCACTCTACCGCCACTATGCC
ATTGGCGTGGCGGGCATGACGTTGCGCAAAGCATTCATGATGACGGCCCGCGACAATCCTCGGCCACAGCAGCAG
CACCATGGGGAGCAAGACGAACACCTGAGCCCGGGCCACCACGGGTCTGCTGGTGACTCGAGTAGCACCTTGTCA
GTTTCGGATGAGCTCGTGTCGGTCAGTGTCAAGGCCTTTTTTGTGCAGATCAAGGCGGAGATGCCTCACGAGCCG
CAGATGCTGCTTCACATCCACGACTTGAACGCGTCGCGTGCTCGGTGGTCGGCACCATGCTTTTCGGCCAATCTG
ATTCGCTTCTGCATCGAGCCGCCGCGGATGCGCAATGTGTGGTCGAGGATGCTGAGCATCAAGGGGATGCGGGCT
GAATGGTGCGAGACGCGGCAAAAGACGGCGCGGGGCGACTTGATTGACGACAACATGATCAACATTACGAGCGAC
GCGGTGCGACTGGCCGTTCCGCACGAGGTGGTTGTCAGCCAAATCCAGGACAACTGCGTAAATGTGGTCAAGGCT
GTTGCTCAGCTCCATCACCGCTTCAAGACGGGCACCAATGAATACATTTTGGACAAGAAGCCCGAGGGGCCCAAA
AAGGTGCCCAAGATGCGCATCAGAGCCGAGAATTTCCTGCTGGAACTCGAGGATGGCGCCTTTGAGTGGAAGCTG
GGCATCATTTACCGGGCTGGGCGCATCGAGCAGATTCAAAGGCTGGCTCGCGAGGAGGCATTTTTGTACAAGGCC
AAAAAGGCGAGGGAGCAGGCGCGCAAAGGCCGCTCTCGCTCAATTGCGGCGCGGGGACGCACAGCCCATGGATCG
TCGTCGTCGGCGTGGTTCAGAAGCCACAGCGAAGACGGGCGTGTGGGCGCAGCGCACATGCGGCCTCGCTACGAC
CCCGAGGGCGACAGCATTGGCATCAATGGCAATGCCAAGGTGGGCGAGGAGGAGGCGCGGGCGCGGCTCAATGTC
TTTAATGCGCAGTCGTGGCAGCAGCGCATCAACCTTGCCTACCAAGAGTCTCAGGACCGCGTCAAGGAGCAGCGA
GTGGTTTTCTGGGGCAACGACGAGCTGCCACAAGAGGTGGAGGTGACGGAGAAGATTTTGGCGGTGCCTCCGCGC
CCAGCACTGCTGTCGGCCGTGATGCGGGCGCTCGTGGTGAATATTGACAAGCCCAGCTTTGCCATGCAGAGCCTG
CCCGACTTTATCCACCGCGTGGGCAAGGGCATGCCGCGAGACATGAAGTATGGCTTGCTGGTGCCCATGCACATT
GGCATCACCATGACGGAGGCGCTCATTTCGCTGCGCGACTATCCGCTGCCGCTGCTACACATACCCGGGTTCAAG
GGTAGCCACCGGCCCGGCACTGTGTCGATTCAGGCCAACTTTGTCGTGGCTGAGGAGTTTCGAGGCATGGAGTCG
ACGCGGCGGGTGCTGGTGAATGTGGTGCCGCCGCGGCACACGGGCCCCGACTCGACAAAGCACGGCAGCTTTGCG
ATAGAAGTGCGGCGGACGATTGGGCCCATCAAGTCGTTTTCCGAGGTGGACATGGACATTCACACGGGACTGCCG
ACGCGCATCACGTGGGCGCCCTGCTACCAGCCAGCCATTCAGGACGTCATGATGGTGATTGAGTCGTTTACCAAG
CCGCCGGTGGATCCGTCGGAGCGCGTCGGCTTCTGGGACAAGATCCGGCTGACGATGCACTCGCGGGTGCACGTG
GCCTGGAAGGGCGACGGCGACATGCATCTGGTGCTCAAGGGGTCGCGCGACCCCTATTACGTGACGGGCACGGGG
GCTGGCTTCATCATGTGCTGGCGCAACGAGGTGCGGTGGAACATCAACTGCGAAGACGACCCCAAGCGCTTCATG
ACGGTGGACAGCGGCGAGTTCATTTGGGCGGTGCCCGACTTTAGCTACCTGGTGCGTAGCGCGGCGCAGCGTGAC
GGGCGCTTCCTGGACAGCGGCAGCCGGTCAGGGGCCGCCTTTCAAAAGGTGGTGATGAAGCTGTCGGGCAAGGTG
CAGTGGATGGCGGGCTTGGTCTTTGAGCAGGCCATTGAGGGCGGCAAGAGGAACTTTGACTTTGTGCCGCACTAC
GACGTGGTGCTCAAGCACCCGCACTTTGCCAAGCCCGACGACGACGGGCTGCCCTATGATGCCATGCGAGGCTTC
CGCAGCCGCCATATTCACCTCTCGATTGCGGTGCGCGCCCCTGCCGACCGCGACTGGACGTCGCAGTTTCCCGAG
CCGTCTCGAAGCTACAACACGGTGCACTTTACGCCGCGCTTCTTTACGCACTTTTTCCAGTGGTGGGCGCTCTTT
AGCCAGCAAACCATGCCCATTCGCCAGGGGAGCCTGTTTCCCGCGCGCGAGAAGAATAGCAAAAAGTTTGGCCGC
CACTTGGCCACGGTCAAGTACAGCCTGTTGCTTGCGCCCCTCTTCCTCAGCCACATTTACAAGCACAAGGACGCC
GAGGACTACGCCGAGGATGCCGTGTCTGCCACGGGCCTCAAGGTGCGCTTCGACAGCTGGATGCTGGACCTGCAC
CAGCGGCGAGAAGAGTTCAACACGCTGGGCAAGGGCCGCAATGCCCAGGGCCGCACCTCTGCCATCAAGATCCAC
GCGGCCCAGCTGGATCTGGCCAGCGCCGATGTGCGTGCCGTGTCGGCGAGTATCAAGGGTACCACGACGGAAGCC
ATCAAAAAGGGCTCTCTGGCAGGCCTCGTTGTCGACCAGGACGACAAGCCCGACTTGTCCAAGTTCATCATACCC
GACAATGACTTTAGCTGGATCGACATGGACGACTTTGTCGAGCTCGACTGGATCCTGCCGACGGAGCCGCATCCT
CGCACCAAGATACTGCCGCTGGCATTTGCGCCTCGGCTGACGTACTTTCGGCAGACGGACATTGGCGGCACCATT
GCAGGAGACCCGTCGAGGACAAGCCCGTTTGGCTCAGAGCCGACGCACTTTTGCATCACGTCGTACGACGACGAT
CCCAAGCGCGTGCAAGGCGAGCTGGTGCAGGAGCGGCTCGACCAGCTCGAGGACCAGATGCTGCAGCACTCGAGA
GACGTGGGCGATGCAGAGCTCAAGGTGATTCAGATGAATGCGCAAGACGGCGAGCTCGTGGCCAACCTGGAGGCG
CTGCGCAAGCACTCGGGCGTCTTGAAGGACAAGAAGATATTCTTGGAAAACATGCTGGAGCAGATTCAAGGCGAC
GGGGGCCGGCGGTCGTCGCTGGCGCCGGGCGATGGCCAAGAGACGCTCGACTTGCCGTCGGCAGCGCGGTTTGAG
AGCGAGTTTACCAACCGCTTCGTCATTCATAACATGCAGCTCAAGTGGAACAATATGCTGCGCAACATTGTGCTG
CGCTACATTCACCAGAATAGCCAGCGGCGCGGCTTTGTCTACTACCTGTCGCGGCCAGCCATCAAGTTTATCCTG
GACATTGTGGAGGAGCAGAGCCGGAGCAAGACGGGCCCCAAGGCGGCATCCAGCAAGACGGGGCCAGCCTGGGCC
TCGTCGCCCGACATGAATGCGGGGGAGAGCGGAAGCGACTTTGCAGAGCGCATCCGCAAGATTCTGGGGGACCGC
GGGGCGTCGGCGAGCGGCAGCTTTGTGACGAATGGCGACGGCAGCTGCACGGCGATTGAGGATCTGGAGAGCGGC
ATCTCGGACGGCTTCAGCCTGCAGCGCGGCTACCACGTGCGGCTGATTGCGCCGCAGATCCAGCTGCAGAGCGAC
AAGAACAAGAAGCACGTGGTGCTGGTGACGGCCAAGGGCATGGAGCTCAAGGTGGTGGAGGTGATGGACAAGGAG
CGCATCTCGGACTCGGTGAGCGGGCTGGTGCAGCGGCGCTTCCTGGTCAACATGGACAGCACGCAGTTCTTTGTG
ACGCACCAAAAGTGGTTTGCCACGAGCCTCGTGTCCATGTATGCAGGCAGCAAGTACGGGGCGCCCAACGGGTCG
TCGTGGCCGCCGTGGGTGCCGCTGGAAATCATGTTTAGCTTCACGGCGGACCCGTTTGGCTTCAAGCGCGTGGTG
CAAAAGACATCGGCCATGCTGCGCTACGACAAGTACAACAATTTGCGGCTCAAGTACAATGACGAGGTGAATGAC
GGGGCCGAGACGGCGAGCGCGGGCAGCAAGACGGAGGCGACGCCCGAGACGCGGCTCGACAACATTTGGGTCGAG
TTCCCGCAGGCGCGGGCGCTGTGCAACTCGTCGCAGTACTATGCCATGTACGTGATTGGGCTGGACCTGCTCATG
TACAATGAGCCGCTGGAGAAGACGCGCAGCGAGCGGCTCGAGAAGATTATGCTGGCGTCCGACTTTAGCGACCTG
AGCGGCGCGCCGCAACTGGTGCAGCGGCTGCAGCAGCGCATCAAGCAGCTCGAGGCCATCAAGCTGCACTTCCAG
ACCTACTCGGCCGCCCTGGACCGCAAGGGCTGGGAGGACCGCCTGTCGCTGGAGCGCGACTTGGCGGCGTGCGAG
GACGAGCTCTTTTTTGTCATGAAGGCCATTACCACGTCGCAGCGCAAGCACGACGCCAGCGGCAGCGACGTGACG
GCCCTGCTGCGGTGGAGCATTTCGGCCCGCGAGATTGTCTGGCACCTGGTGCAGGACTCCAACGAGCCGCTGGTG
GAGCTGCAGCTCAAGGAGGTTGAGTATGACCGCACCGACAACTCGGACGGCTCCCACATGAACCTGATGCGCGTC
GGCAAGATTCTCGGCCTCAACCTGCTGCCCGACGCCACCTACCCCGAGATTATTGCGCCCTACCACGGCCACGAC
AAGGGGTCCACGGTGGACGACAGCGACATGATTCGCGTCTACTGGCACATGCTCGAGGCCATTGCCGGCATCCCC
GTCATGGACTGCTTCGAGGTGACGCTCTTCCCCGTCAAGATTCAGCTGGAGCGCGACGTGGGAAAGCGCCTCTTT
GACTACATCTTTCCCGGCATGGACGGCGACAAGCACGCGTCGACGGCGCGCAGCCACTCGCTCAAGCTTGAGATT
GACGATGACGACGATGACGACGCCAATGGCAACAACAATGAGAGCGACGCAAATAGCCACGCGCCAACGCCCACG
GCACACGCCAGCCCCCCCGCCGGCGGCAGCAGCTTCTCAACGCGGGCCGGCATGCTGGAGCTGCGGCTTAAACCA
ACACTGTGGTCGAATCCGCCGCCGCTGCCGCAGGAGCGCAGCCCCAAGAAGAGCGAGCACTATGGCAGGCGCCTG
CTGCGCTCGGCCGGCACGGGCAAGACGATGCTGTCGAAAAAGGCATCGCACGACTCGCTGCGCAGCTCGCGGCCC
GGGCTGATGCGATCGTCAACGGCCAGCAGCACGCTCAACGAGAGCAAGAAGAGCGCCTCGTCGCGCTTTGGCCTG
CGCCACAAGGGCGGCGACGACGAGGCCGGGGCCAAGCGCGGCAAGGCGCAGTCGGACGACTTGACCAAGATGATG
ACGCGCGCCAGCAGCTACATGACGTTTGCCTCGATTCGCGTGCCGTCGGTGGTGCTGTGCCTGAGCTACAAGGGC
CGCGACCAGCGCAACTTTGAAGACGTGCACGACTTTGTCTTTCGCCTGCCCACCATGGAGTGGCACAACAAGACG
TGGTCCAACCTGGACCTGGCGCTGGCGCTCAAAAAGGCGGTTGTCAAGGCGCTCATTTCCCACACGGGCGCCATT
ATCGGCAACAAGCTGTCCAAGCACCGGCCCAATGCCGAGCAGCGCAGCAGACTGCGCGAGCTGGCCAGCAGCTCC
GCCATCATCTCGGCGCAGCATCTGCAGACCATTACCGCTGGCGGAGGAAGCAGCACCGGCACTCTGCACGACGGG
GCCAGTCTGGACAATAGTGACGACGACTCGAGCCTCTATGGGAGCTGGCCCATTGACTACTCGCGCTCGCCGCCC
ACGAGCAGCGTGCCGCATGGCCGTGCCGCAAGCCGGGGCAGCAGCGCTGCTAGTAGCAACTACTCGCTGACTCGG
TCCGGCAACGCGCCCACTGGCTCGTCGCGGCCGCTGTCGAGCGGCAACGGCAACGGCTTGGGCATTGCAGACGCG
TCGTCGCACCGGCGTCTGCTGCGCGCCATTGGCTCCGATGCCAAGCCTCCTCCTCCTCCTCCTCCTCCGCTGCTG
CCTGGTAGTGGTAGTAGTAGTGCTGCTGCTGCTGCTGCTGCTACACAAGTGTCAGACGGCTCCGGGCTGGCCTTG
AGCCACAGCGGCAACTCGGGCGGCCACCATGTGTCGATTACGGCCGATGGGACCGAGTCGACGACGCGGCGGCAC
GGCGGCGCTGGCGGGGGCTTCCGAGAGCGCATTAGTGCGTTTGCGCATCGGCGGGGGCACCATGAGGAAGAGGGC
GAGGGGGAGGATAGGACGAGGAGCAAGATGCTTAGCTGGGCGCCAGGGAGGAACCGCGCAGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail