Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5769
Gene name
LocationContig_48:30034..32152
Strand-
Gene length (bp)2118
Transcript length (bp)1773
Coding sequence length (bp)1773
Protein length (aa) 591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.0E-12 79 145

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 1 216 2.0E-31
sp|Q5XI72|IF4H_RAT Eukaryotic translation initiation factor 4H OS=Rattus norvegicus GN=Eif4h PE=1 SV=1 69 149 2.0E-15
sp|Q9WUK2|IF4H_MOUSE Eukaryotic translation initiation factor 4H OS=Mus musculus GN=Eif4h PE=1 SV=3 69 149 2.0E-15
sp|Q15056|IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens GN=EIF4H PE=1 SV=5 69 149 2.0E-15
sp|Q5RBR8|IF4H_PONAB Eukaryotic translation initiation factor 4H OS=Pongo abelii GN=EIF4H PE=2 SV=1 69 149 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 1 216 2.0E-31
sp|Q5XI72|IF4H_RAT Eukaryotic translation initiation factor 4H OS=Rattus norvegicus GN=Eif4h PE=1 SV=1 69 149 2.0E-15
sp|Q9WUK2|IF4H_MOUSE Eukaryotic translation initiation factor 4H OS=Mus musculus GN=Eif4h PE=1 SV=3 69 149 2.0E-15
sp|Q15056|IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens GN=EIF4H PE=1 SV=5 69 149 2.0E-15
sp|Q5RBR8|IF4H_PONAB Eukaryotic translation initiation factor 4H OS=Pongo abelii GN=EIF4H PE=2 SV=1 69 149 2.0E-15
sp|Q1JPH6|IF4H_BOVIN Eukaryotic translation initiation factor 4H OS=Bos taurus GN=EIF4H PE=2 SV=1 69 149 2.0E-15
sp|P23588|IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 11 168 5.0E-14
sp|Q8BGD9|IF4B_MOUSE Eukaryotic translation initiation factor 4B OS=Mus musculus GN=Eif4b PE=1 SV=1 11 168 5.0E-13
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 48 151 5.0E-11
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 73 151 1.0E-10
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 66 155 1.0E-10
sp|P34167|IF4B_YEAST Eukaryotic translation initiation factor 4B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF3 PE=1 SV=1 1 155 1.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 78 167 5.0E-08
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 78 146 7.0E-08
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 78 146 7.0E-08
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 66 150 1.0E-07
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 76 146 2.0E-07
sp|Q6NVP7|PABP2_XENTR Polyadenylate-binding protein 2 OS=Xenopus tropicalis GN=pabpn1 PE=2 SV=1 76 146 2.0E-07
sp|Q9DDY9|PAB2A_XENLA Polyadenylate-binding protein 2-A OS=Xenopus laevis GN=pabpn1-a PE=2 SV=1 76 146 2.0E-07
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 78 146 2.0E-07
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 78 146 2.0E-07
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 78 146 2.0E-07
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 76 146 2.0E-07
sp|Q7ZXB8|PAB2B_XENLA Polyadenylate-binding protein 2-B OS=Xenopus laevis GN=pabpn1-b PE=2 SV=1 76 146 2.0E-07
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 76 146 3.0E-07
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 76 146 3.0E-07
sp|Q9SEE9|SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana GN=SR45 PE=1 SV=1 75 153 3.0E-07
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 58 146 4.0E-07
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 76 146 4.0E-07
sp|Q8CCS6|PABP2_MOUSE Polyadenylate-binding protein 2 OS=Mus musculus GN=Pabpn1 PE=1 SV=3 76 146 5.0E-07
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 76 146 5.0E-07
sp|Q86U42|PABP2_HUMAN Polyadenylate-binding protein 2 OS=Homo sapiens GN=PABPN1 PE=1 SV=3 76 146 7.0E-07
sp|Q28165|PABP2_BOVIN Polyadenylate-binding protein 2 OS=Bos taurus GN=PABPN1 PE=1 SV=3 76 146 7.0E-07
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 78 156 2.0E-06
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 75 150 3.0E-06
sp|Q9M9G6|CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 76 160 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5769
MAPKKKEQQKMSLGDFLGEPSFGGSWADEVEESYGTQPLPPSDRPRPSASMSTWQDRGYSVREEVPQRLPDKPPY
TAHLGNLSYDATSESVTEFFGGSDIVSVRIIEDREMQRPKGFGYVEFGNVDGLKKALTLDGQSFQGRVIRIKVAD
PPRGGDGRGDSNRDLSDWTRKGPLPDIPGRSGRQQSDFGERRSRDPAAEARPAREYTWERRGPLSPLAQPEPASR
SREGSRARPGPEGLGERGESHRGNRHAAGAWGEGRQEGSRPPRRENPERVVSAADRDLQWRERMRPDAPGKSSPP
SRDGSEAPPSPSVPAAAPVPAVRPRLNLAKRTVSEAVEATTASAGAGEAKASPFGAARPIDTAAKEKEIEEKRLQ
AIKDKREAEEKAKEEQRLAKQAAAAKAEAEAEKAAKEQAAAKKLAEEKAKAEQQAAVKAAEPEQQAVNSAPQKPN
GASAPEGKGAQRGREGHEAREPREAKEQGGNFKSRAAEAGNWRSASNEQRLGRGGSGGGRGGRGGGGGGRGSRFD
NRGARSNGSPAHHHAQQQQAGQQHLQQQAGQAGGGEAPSKQANAPDEEGWTTVPNKKGRQNRALA*
Coding >OphauB2|5769
ATGGCTCCCAAAAAGAAGGAGCAGCAGAAAATGTCCCTGGGGGACTTTCTGGGCGAACCTAGCTTTGGTGGATCT
TGGGCCGATGAGGTTGAGGAGAGCTATGGCACTCAGCCGTTGCCCCCCAGCGACAGGCCTCGCCCCTCCGCCTCA
ATGTCGACCTGGCAGGATCGAGGCTACTCGGTTCGCGAAGAGGTGCCCCAAAGATTGCCAGACAAGCCTCCATAC
ACAGCTCACTTGGGCAATTTGTCCTATGACGCGACGTCGGAATCGGTGACTGAATTTTTTGGTGGAAGCGACATT
GTCAGCGTTCGCATCATTGAAGATCGCGAAATGCAACGTCCCAAGGGCTTTGGCTACGTGGAATTCGGCAACGTT
GACGGACTCAAGAAGGCTCTCACTCTTGATGGCCAGTCCTTTCAGGGCCGAGTCATTAGGATCAAGGTGGCGGAT
CCTCCCCGTGGTGGAGACGGCCGAGGTGATTCCAATCGCGACTTGAGCGACTGGACTCGCAAGGGACCTCTGCCA
GATATTCCAGGCAGAAGCGGACGCCAGCAGTCCGACTTTGGTGAGCGTCGCTCTCGGGACCCGGCCGCCGAAGCT
CGCCCTGCCCGTGAATATACGTGGGAGCGCCGCGGCCCTCTTTCCCCACTGGCGCAACCAGAGCCCGCGTCCCGA
TCTCGAGAGGGCAGTCGTGCACGCCCTGGGCCCGAAGGCCTTGGTGAACGAGGCGAATCTCACCGCGGCAACAGA
CACGCGGCTGGTGCTTGGGGCGAAGGGCGTCAGGAAGGCTCCCGCCCCCCGCGTCGGGAAAACCCGGAGCGCGTT
GTAAGCGCGGCCGACAGGGATTTGCAATGGAGAGAGCGCATGCGCCCCGATGCGCCCGGCAAGTCGAGCCCTCCG
TCGCGTGACGGCAGCGAAGCTCCGCCATCGCCATCTGTGCCAGCAGCGGCGCCGGTGCCTGCTGTGCGTCCCCGA
CTGAATCTGGCGAAACGGACAGTATCCGAGGCTGTAGAGGCGACGACGGCTTCGGCTGGCGCGGGCGAGGCCAAG
GCCAGCCCCTTTGGCGCAGCTCGGCCCATTGACACGGCTGCCAAGGAGAAGGAGATTGAAGAAAAGAGGCTGCAG
GCCATCAAGGACAAGCGCGAGGCTGAGGAAAAGGCCAAGGAGGAGCAGCGTCTAGCCAAGCAGGCAGCTGCGGCC
AAGGCTGAAGCCGAAGCAGAAAAGGCGGCCAAGGAGCAGGCAGCGGCCAAGAAGCTTGCCGAGGAAAAGGCCAAG
GCGGAGCAGCAGGCAGCAGTCAAGGCAGCGGAGCCGGAGCAGCAGGCAGTGAATTCGGCGCCGCAGAAGCCCAAT
GGGGCATCGGCGCCTGAAGGCAAGGGGGCGCAGCGAGGACGCGAAGGCCACGAAGCACGCGAGCCACGAGAGGCC
AAGGAGCAAGGAGGCAACTTCAAGTCGAGAGCAGCCGAGGCGGGCAACTGGAGATCAGCGTCGAATGAGCAGCGG
CTGGGACGCGGAGGATCTGGCGGAGGCCGAGGCGGACGAGGGGGCGGCGGGGGTGGACGAGGGTCGCGCTTCGAC
AATCGCGGCGCACGGTCCAATGGATCGCCTGCACACCATCATGCTCAGCAGCAGCAGGCGGGACAGCAGCATTTG
CAGCAGCAGGCGGGACAAGCAGGCGGCGGCGAGGCGCCAAGCAAGCAGGCGAATGCGCCAGATGAAGAAGGATGG
ACCACGGTTCCAAATAAAAAGGGACGACAGAACCGTGCTTTGGCATAG
Transcript >OphauB2|5769
ATGGCTCCCAAAAAGAAGGAGCAGCAGAAAATGTCCCTGGGGGACTTTCTGGGCGAACCTAGCTTTGGTGGATCT
TGGGCCGATGAGGTTGAGGAGAGCTATGGCACTCAGCCGTTGCCCCCCAGCGACAGGCCTCGCCCCTCCGCCTCA
ATGTCGACCTGGCAGGATCGAGGCTACTCGGTTCGCGAAGAGGTGCCCCAAAGATTGCCAGACAAGCCTCCATAC
ACAGCTCACTTGGGCAATTTGTCCTATGACGCGACGTCGGAATCGGTGACTGAATTTTTTGGTGGAAGCGACATT
GTCAGCGTTCGCATCATTGAAGATCGCGAAATGCAACGTCCCAAGGGCTTTGGCTACGTGGAATTCGGCAACGTT
GACGGACTCAAGAAGGCTCTCACTCTTGATGGCCAGTCCTTTCAGGGCCGAGTCATTAGGATCAAGGTGGCGGAT
CCTCCCCGTGGTGGAGACGGCCGAGGTGATTCCAATCGCGACTTGAGCGACTGGACTCGCAAGGGACCTCTGCCA
GATATTCCAGGCAGAAGCGGACGCCAGCAGTCCGACTTTGGTGAGCGTCGCTCTCGGGACCCGGCCGCCGAAGCT
CGCCCTGCCCGTGAATATACGTGGGAGCGCCGCGGCCCTCTTTCCCCACTGGCGCAACCAGAGCCCGCGTCCCGA
TCTCGAGAGGGCAGTCGTGCACGCCCTGGGCCCGAAGGCCTTGGTGAACGAGGCGAATCTCACCGCGGCAACAGA
CACGCGGCTGGTGCTTGGGGCGAAGGGCGTCAGGAAGGCTCCCGCCCCCCGCGTCGGGAAAACCCGGAGCGCGTT
GTAAGCGCGGCCGACAGGGATTTGCAATGGAGAGAGCGCATGCGCCCCGATGCGCCCGGCAAGTCGAGCCCTCCG
TCGCGTGACGGCAGCGAAGCTCCGCCATCGCCATCTGTGCCAGCAGCGGCGCCGGTGCCTGCTGTGCGTCCCCGA
CTGAATCTGGCGAAACGGACAGTATCCGAGGCTGTAGAGGCGACGACGGCTTCGGCTGGCGCGGGCGAGGCCAAG
GCCAGCCCCTTTGGCGCAGCTCGGCCCATTGACACGGCTGCCAAGGAGAAGGAGATTGAAGAAAAGAGGCTGCAG
GCCATCAAGGACAAGCGCGAGGCTGAGGAAAAGGCCAAGGAGGAGCAGCGTCTAGCCAAGCAGGCAGCTGCGGCC
AAGGCTGAAGCCGAAGCAGAAAAGGCGGCCAAGGAGCAGGCAGCGGCCAAGAAGCTTGCCGAGGAAAAGGCCAAG
GCGGAGCAGCAGGCAGCAGTCAAGGCAGCGGAGCCGGAGCAGCAGGCAGTGAATTCGGCGCCGCAGAAGCCCAAT
GGGGCATCGGCGCCTGAAGGCAAGGGGGCGCAGCGAGGACGCGAAGGCCACGAAGCACGCGAGCCACGAGAGGCC
AAGGAGCAAGGAGGCAACTTCAAGTCGAGAGCAGCCGAGGCGGGCAACTGGAGATCAGCGTCGAATGAGCAGCGG
CTGGGACGCGGAGGATCTGGCGGAGGCCGAGGCGGACGAGGGGGCGGCGGGGGTGGACGAGGGTCGCGCTTCGAC
AATCGCGGCGCACGGTCCAATGGATCGCCTGCACACCATCATGCTCAGCAGCAGCAGGCGGGACAGCAGCATTTG
CAGCAGCAGGCGGGACAAGCAGGCGGCGGCGAGGCGCCAAGCAAGCAGGCGAATGCGCCAGATGAAGAAGGATGG
ACCACGGTTCCAAATAAAAAGGGACGACAGAACCGTGCTTTGGCATAG
Gene >OphauB2|5769
ATGGGTGCGTTTGCCAGCCAAAAGGCCCTTGATGCAAAGCCGTGTTTGCTGACTCGTTATAGCTCCCAAAAAGAA
GGAGCAGCAGAAAATGTCCCTGGGGGACTTTCTGGGCGAACCTAGTTGGTCTCTCCCCGCACCATGGACCTGACT
GTGTGCATTTTTTTATTTTTTTACTTGGCATCTCTAACTATTTTTCTTGCAGGCTTTGGTGGATCTTGGGCCGAT
GAGGTTGAGGAGAGCTATGGTGCGTAAAAGTTGTTGCTCAATGGAGCACACCACGAGGCCTCTTGGCCGCCCTGC
TGCGTTTATACTTGCAAGATATTGATTGCTACATGTCTAGGCACTCAGCCGTTGCCCCCCAGCGACAGGCCTCGC
CCCTCCGCCTCAATGTCGACCTGGCAGGATCGAGGTAAGCAAAGCTTTCTCATCAGCATGTTTTCTCGTTGCTAA
CTGTGCACTAGGCTACTCGGTTCGCGAAGAGGTGCCCCAAAGATTGCCAGACAAGCCTCCATACACAGCTCACTT
GGGCAATTTGTCCTATGACGCGACGTCGGAATCGGTGACTGAATTTTTTGGTGGAAGCGACATTGTCAGCGTTCG
CATCATTGAAGATCGCGAAATGCAACGTCCCAAGGGCTTTGGCTACGTGGAATTCGGCAACGTTGACGGACTCAA
GAAGGCTCTCACTCTTGATGGCCAGTCCTTTCAGGGCCGAGTCATTAGGATCAAGGTGGCGGATCCTCGTACGTT
TGCTTCCCTGTCCAACTTGGCCAATATGCGCTTATTCCTGTCATGCTAGCCCGTGGTGGAGACGGCCGAGGTGAT
TCCAATCGCGACTTGAGCGACTGGACTCGCAAGGGACCTCTGCCAGATATTCCAGGCAGAAGCGGACGCCAGCAG
TCCGACTTTGGTGAGCGTCGCTCTCGGGACCCGGCCGCCGAAGCTCGCCCTGCCCGTGAATATACGTGGGAGCGC
CGCGGCCCTCTTTCCCCACTGGCGCAACCAGAGCCCGCGTCCCGATCTCGAGAGGGCAGTCGTGCACGCCCTGGG
CCCGAAGGCCTTGGTGAACGAGGCGAATCTCACCGCGGCAACAGACACGCGGCTGGTGCTTGGGGCGAAGGGCGT
CAGGAAGGCTCCCGCCCCCCGCGTCGGGAAAACCCGGAGCGCGTTGTAAGCGCGGCCGACAGGGATTTGCAATGG
AGAGAGCGCATGCGCCCCGATGCGCCCGGCAAGTCGAGCCCTCCGTCGCGTGACGGCAGCGAAGCTCCGCCATCG
CCATCTGTGCCAGCAGCGGCGCCGGTGCCTGCTGTGCGTCCCCGACTGAATCTGGCGAAACGGACAGTATCCGAG
GCTGTAGAGGCGACGACGGCTTCGGCTGGCGCGGGCGAGGCCAAGGCCAGCCCCTTTGGCGCAGCTCGGCCCATT
GACACGGCTGCCAAGGAGAAGGAGATTGAAGAAAAGAGGCTGCAGGCCATCAAGGACAAGCGCGAGGCTGAGGAA
AAGGCCAAGGAGGAGCAGCGTCTAGCCAAGCAGGCAGCTGCGGCCAAGGCTGAAGCCGAAGCAGAAAAGGCGGCC
AAGGAGCAGGCAGCGGCCAAGAAGCTTGCCGAGGAAAAGGCCAAGGCGGAGCAGCAGGCAGCAGTCAAGGCAGCG
GAGCCGGAGCAGCAGGCAGTGAATTCGGCGCCGCAGAAGCCCAATGGGGCATCGGCGCCTGAAGGCAAGGGGGCG
CAGCGAGGACGCGAAGGCCACGAAGCACGCGAGCCACGAGAGGCCAAGGAGCAAGGAGGCAACTTCAAGTCGAGA
GCAGCCGAGGCGGGCAACTGGAGATCAGCGTCGAATGAGCAGCGGCTGGGACGCGGAGGATCTGGCGGAGGCCGA
GGCGGACGAGGGGGCGGCGGGGGTGGACGAGGGTCGCGCTTCGACAATCGCGGCGCACGGTCCAATGGATCGCCT
GCACACCATCATGCTCAGCAGCAGCAGGCGGGACAGCAGCATTTGCAGCAGCAGGCGGGACAAGCAGGCGGCGGC
GAGGCGCCAAGCAAGCAGGCGAATGCGCCAGATGAAGAAGGATGGACCACGGTTCCAAATAAAAAGGGACGACAG
AACCGTGCTTTGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail