Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5766
Gene name
LocationContig_48:24116..27381
Strand+
Gene length (bp)3265
Transcript length (bp)3138
Coding sequence length (bp)3138
Protein length (aa) 1046

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00582 Usp Universal stress protein family 9.5E-14 50 185

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74782|YGBA_SCHPO Universal stress protein A family protein C25B2.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25B2.10 PE=1 SV=1 12 210 1.0E-39
sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 45 203 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5766
MARLTTDSNARFQRHVGFDNVPNGEFTRNNTLSLVLNVRHKGYQAKRRSRTFMVGIDENSYSDYAIQWLLDELVD
DGDEIVCVHVAEKDQRCQIDSSKYQDDANALMESIIAKNGASLAVSFILEYAVGKLHATFQKLIQMYQPAMLIVG
TRGRSFGGIQGLVNSRNSFSKYCLQYSPVPVVVVRPTEKRIKKKVKRAHDSTRQTYLGMLAATNGRHEADSESSS
AYDLEIQGTPDEEAHQVAKVLGLPAKYDPTIKPLAIGLLPRSRPASPFQAAQAAEAQRVVDTSPTSAGAESDFDE
DDYEPDFDVMDGGQALNQQKKLEHLHEMEADEAAALRKGVEEVDADSDEKSASTGAPSRQPAVAGGACVAGSGRS
NLASQPWDYDQCAPFWRVYDESTESETLVPQKEQDVKDEVASKASSERLNVIVEEESSDSDGDDVGDAAPHEADG
NQEQCARQPQVMQAYTSTMRTGAGAKVYQVDVAASCTDERLGKAQDAVVACGSDGTQEEDAATAGDKARTAIRKM
RMEHGERSREVRRRVAREQDCVLSQEDYAVEGIEVRDFAHPESAELPSNLVNPWATEATCTADVCATSVMYEAHE
SGPSANLKGGPCPSDGDLTVAMVAEADAMPWDEASGEQAPSRSQSGHVYDVSRQASQAEWRTAVDEALPQTHEQS
LQGQEPGARHRASLLQDEATEAEPLLQAAPDCAEAEYLLQGEAPLQQTYWPSDAEPAWSNLPCAAVESARGDGPP
MAGYWSDQEADGRRPRAEAAIWARSPRALYRGRRVRRQWSSDEGRQWQAEALSLIEEDASIAEGLAWEAKTRPPR
AQGPRWMSGPSFRRGHLHTGYRGAGGPPAVIHRQMQASSVAASPLGRSPERTRNYKTHQPSPLRQEVDASQAGPS
SRRREQRRVEPRGDSIEVERPLWPKRGASPARGTPDSPYSIVDAEVERQRLGYCGGSQGQAQEYRGVKSSSSFWK
GKGRAVVPEEAQRLTGRNHGLRSLRPLAEGDAVPALYELGGVPVDDDEASEHWSGSERAAWKRWICACFK*
Coding >OphauB2|5766
ATGGCACGACTAACCACGGATTCAAACGCCAGGTTCCAGCGTCATGTCGGCTTCGACAATGTTCCCAATGGAGAG
TTTACTAGAAATAACACGCTTTCGCTCGTTCTCAATGTTCGCCACAAGGGTTACCAAGCCAAGCGTAGGTCGCGG
ACTTTTATGGTTGGCATTGATGAAAATTCTTATTCGGATTACGCAATTCAGTGGCTTCTCGACGAGCTTGTGGAC
GATGGCGACGAAATCGTCTGCGTTCACGTTGCCGAGAAGGACCAACGATGCCAAATTGACAGCAGCAAGTACCAA
GATGATGCAAACGCCCTCATGGAGAGCATCATTGCCAAGAATGGAGCCAGCCTTGCCGTGAGCTTCATTTTGGAA
TACGCTGTGGGAAAGCTTCATGCCACCTTTCAGAAACTGATTCAAATGTATCAACCTGCTATGCTCATTGTTGGC
ACTAGAGGCAGATCCTTTGGTGGTATCCAAGGCCTTGTCAACTCGCGAAACTCGTTTTCAAAGTACTGTTTACAG
TACTCGCCGGTTCCCGTTGTTGTTGTCCGACCGACCGAGAAGCGCATCAAGAAGAAGGTTAAGCGCGCACATGAT
TCAACTCGGCAAACATATCTTGGCATGTTGGCGGCTACTAATGGGCGCCACGAGGCCGATAGCGAGTCGAGTAGT
GCTTATGATCTCGAGATTCAAGGCACTCCAGACGAGGAGGCGCACCAGGTGGCCAAGGTGCTGGGTCTTCCTGCC
AAGTACGACCCGACGATTAAGCCACTGGCAATTGGCTTGCTGCCACGATCGCGGCCGGCGAGCCCGTTTCAAGCG
GCTCAGGCGGCAGAGGCGCAGCGCGTCGTGGACACTTCGCCCACTAGCGCCGGGGCTGAAAGTGACTTTGACGAG
GACGATTACGAGCCCGACTTTGACGTTATGGACGGAGGCCAGGCCCTAAATCAACAGAAAAAGCTGGAACACCTT
CACGAGATGGAGGCTGACGAGGCCGCTGCTCTGCGCAAGGGTGTCGAAGAGGTGGACGCCGATTCGGACGAAAAG
TCGGCCTCTACTGGTGCTCCATCTCGCCAGCCCGCCGTGGCTGGTGGTGCCTGTGTTGCTGGGTCCGGACGTAGC
AATTTGGCGAGCCAACCATGGGACTACGACCAATGTGCTCCTTTTTGGCGGGTCTATGACGAGTCGACTGAATCC
GAAACTCTTGTACCACAAAAGGAGCAAGATGTAAAGGACGAGGTTGCGAGCAAAGCGTCGAGCGAAAGGCTCAAT
GTCATTGTCGAGGAGGAGTCTAGCGACAGCGACGGCGATGACGTTGGAGACGCGGCACCTCACGAGGCAGATGGC
AATCAAGAGCAGTGTGCGAGGCAGCCGCAGGTTATGCAAGCATACACGTCTACCATGAGGACGGGAGCGGGCGCT
AAAGTATACCAAGTGGATGTAGCGGCATCTTGTACTGATGAGCGCCTCGGCAAGGCACAAGACGCTGTTGTTGCT
TGTGGAAGTGATGGGACTCAAGAAGAGGATGCGGCAACGGCTGGCGACAAGGCGCGCACTGCGATTCGAAAGATG
CGAATGGAGCATGGCGAACGCAGCAGGGAAGTCCGACGCAGAGTGGCACGGGAACAAGATTGCGTACTGAGCCAA
GAAGATTATGCGGTGGAGGGGATTGAAGTGCGAGATTTTGCGCACCCAGAGTCTGCAGAGCTACCATCAAACTTG
GTGAATCCATGGGCAACGGAAGCAACGTGTACAGCAGATGTGTGTGCGACAAGTGTGATGTACGAGGCGCACGAG
TCTGGACCCAGTGCAAACTTGAAGGGCGGTCCATGTCCATCTGATGGAGACTTGACTGTTGCAATGGTGGCAGAG
GCTGATGCAATGCCATGGGACGAGGCATCAGGCGAGCAGGCGCCCAGTCGGTCTCAGTCTGGGCACGTCTACGAT
GTATCACGACAGGCGAGTCAAGCAGAGTGGCGTACAGCAGTGGATGAGGCATTGCCGCAAACGCACGAGCAATCG
CTGCAAGGACAAGAGCCAGGGGCAAGGCACCGAGCGTCGTTGTTGCAAGATGAAGCGACAGAGGCTGAGCCACTG
CTGCAGGCTGCTCCCGATTGTGCAGAGGCTGAATACTTGCTACAAGGCGAGGCGCCGTTGCAGCAGACTTATTGG
CCGTCTGATGCAGAGCCAGCATGGTCAAATCTGCCGTGTGCTGCAGTGGAGTCGGCACGAGGGGATGGACCGCCG
ATGGCTGGATACTGGTCAGATCAAGAGGCGGATGGACGGAGGCCAAGGGCAGAAGCAGCGATTTGGGCACGTTCG
CCACGGGCTTTGTATCGAGGGCGACGAGTGCGACGACAATGGAGCAGCGACGAAGGACGTCAATGGCAGGCTGAA
GCTTTGTCATTGATAGAGGAGGACGCGTCGATTGCTGAAGGGTTGGCGTGGGAAGCCAAGACTAGACCGCCTCGA
GCACAGGGACCTCGATGGATGTCGGGACCGTCGTTTCGCCGCGGCCACTTACATACTGGATATCGGGGTGCAGGC
GGCCCGCCAGCCGTGATTCACCGGCAGATGCAGGCGTCATCGGTAGCGGCGAGTCCGTTGGGCCGGTCACCGGAG
CGGACACGCAACTACAAGACGCACCAGCCGTCGCCGCTGCGGCAAGAAGTGGATGCGAGCCAGGCGGGGCCCTCG
AGTAGAAGAAGAGAGCAACGCCGGGTCGAGCCTCGAGGGGACAGTATAGAGGTTGAGCGGCCTCTTTGGCCCAAG
CGTGGCGCGTCACCAGCCAGGGGAACTCCCGACTCGCCCTACTCGATTGTCGACGCCGAGGTGGAGCGCCAACGA
CTAGGCTACTGTGGAGGCAGCCAGGGCCAGGCGCAAGAGTATCGAGGAGTCAAGTCGTCGTCTTCCTTTTGGAAG
GGCAAGGGACGCGCCGTGGTGCCAGAGGAAGCGCAAAGGCTGACTGGCAGGAATCACGGGCTGCGCTCTCTGCGT
CCATTGGCAGAAGGCGATGCGGTGCCGGCGCTGTACGAGCTGGGCGGAGTGCCTGTAGATGACGATGAGGCGAGT
GAGCACTGGTCGGGATCTGAGCGAGCGGCGTGGAAGCGATGGATTTGCGCATGTTTTAAGTAG
Transcript >OphauB2|5766
ATGGCACGACTAACCACGGATTCAAACGCCAGGTTCCAGCGTCATGTCGGCTTCGACAATGTTCCCAATGGAGAG
TTTACTAGAAATAACACGCTTTCGCTCGTTCTCAATGTTCGCCACAAGGGTTACCAAGCCAAGCGTAGGTCGCGG
ACTTTTATGGTTGGCATTGATGAAAATTCTTATTCGGATTACGCAATTCAGTGGCTTCTCGACGAGCTTGTGGAC
GATGGCGACGAAATCGTCTGCGTTCACGTTGCCGAGAAGGACCAACGATGCCAAATTGACAGCAGCAAGTACCAA
GATGATGCAAACGCCCTCATGGAGAGCATCATTGCCAAGAATGGAGCCAGCCTTGCCGTGAGCTTCATTTTGGAA
TACGCTGTGGGAAAGCTTCATGCCACCTTTCAGAAACTGATTCAAATGTATCAACCTGCTATGCTCATTGTTGGC
ACTAGAGGCAGATCCTTTGGTGGTATCCAAGGCCTTGTCAACTCGCGAAACTCGTTTTCAAAGTACTGTTTACAG
TACTCGCCGGTTCCCGTTGTTGTTGTCCGACCGACCGAGAAGCGCATCAAGAAGAAGGTTAAGCGCGCACATGAT
TCAACTCGGCAAACATATCTTGGCATGTTGGCGGCTACTAATGGGCGCCACGAGGCCGATAGCGAGTCGAGTAGT
GCTTATGATCTCGAGATTCAAGGCACTCCAGACGAGGAGGCGCACCAGGTGGCCAAGGTGCTGGGTCTTCCTGCC
AAGTACGACCCGACGATTAAGCCACTGGCAATTGGCTTGCTGCCACGATCGCGGCCGGCGAGCCCGTTTCAAGCG
GCTCAGGCGGCAGAGGCGCAGCGCGTCGTGGACACTTCGCCCACTAGCGCCGGGGCTGAAAGTGACTTTGACGAG
GACGATTACGAGCCCGACTTTGACGTTATGGACGGAGGCCAGGCCCTAAATCAACAGAAAAAGCTGGAACACCTT
CACGAGATGGAGGCTGACGAGGCCGCTGCTCTGCGCAAGGGTGTCGAAGAGGTGGACGCCGATTCGGACGAAAAG
TCGGCCTCTACTGGTGCTCCATCTCGCCAGCCCGCCGTGGCTGGTGGTGCCTGTGTTGCTGGGTCCGGACGTAGC
AATTTGGCGAGCCAACCATGGGACTACGACCAATGTGCTCCTTTTTGGCGGGTCTATGACGAGTCGACTGAATCC
GAAACTCTTGTACCACAAAAGGAGCAAGATGTAAAGGACGAGGTTGCGAGCAAAGCGTCGAGCGAAAGGCTCAAT
GTCATTGTCGAGGAGGAGTCTAGCGACAGCGACGGCGATGACGTTGGAGACGCGGCACCTCACGAGGCAGATGGC
AATCAAGAGCAGTGTGCGAGGCAGCCGCAGGTTATGCAAGCATACACGTCTACCATGAGGACGGGAGCGGGCGCT
AAAGTATACCAAGTGGATGTAGCGGCATCTTGTACTGATGAGCGCCTCGGCAAGGCACAAGACGCTGTTGTTGCT
TGTGGAAGTGATGGGACTCAAGAAGAGGATGCGGCAACGGCTGGCGACAAGGCGCGCACTGCGATTCGAAAGATG
CGAATGGAGCATGGCGAACGCAGCAGGGAAGTCCGACGCAGAGTGGCACGGGAACAAGATTGCGTACTGAGCCAA
GAAGATTATGCGGTGGAGGGGATTGAAGTGCGAGATTTTGCGCACCCAGAGTCTGCAGAGCTACCATCAAACTTG
GTGAATCCATGGGCAACGGAAGCAACGTGTACAGCAGATGTGTGTGCGACAAGTGTGATGTACGAGGCGCACGAG
TCTGGACCCAGTGCAAACTTGAAGGGCGGTCCATGTCCATCTGATGGAGACTTGACTGTTGCAATGGTGGCAGAG
GCTGATGCAATGCCATGGGACGAGGCATCAGGCGAGCAGGCGCCCAGTCGGTCTCAGTCTGGGCACGTCTACGAT
GTATCACGACAGGCGAGTCAAGCAGAGTGGCGTACAGCAGTGGATGAGGCATTGCCGCAAACGCACGAGCAATCG
CTGCAAGGACAAGAGCCAGGGGCAAGGCACCGAGCGTCGTTGTTGCAAGATGAAGCGACAGAGGCTGAGCCACTG
CTGCAGGCTGCTCCCGATTGTGCAGAGGCTGAATACTTGCTACAAGGCGAGGCGCCGTTGCAGCAGACTTATTGG
CCGTCTGATGCAGAGCCAGCATGGTCAAATCTGCCGTGTGCTGCAGTGGAGTCGGCACGAGGGGATGGACCGCCG
ATGGCTGGATACTGGTCAGATCAAGAGGCGGATGGACGGAGGCCAAGGGCAGAAGCAGCGATTTGGGCACGTTCG
CCACGGGCTTTGTATCGAGGGCGACGAGTGCGACGACAATGGAGCAGCGACGAAGGACGTCAATGGCAGGCTGAA
GCTTTGTCATTGATAGAGGAGGACGCGTCGATTGCTGAAGGGTTGGCGTGGGAAGCCAAGACTAGACCGCCTCGA
GCACAGGGACCTCGATGGATGTCGGGACCGTCGTTTCGCCGCGGCCACTTACATACTGGATATCGGGGTGCAGGC
GGCCCGCCAGCCGTGATTCACCGGCAGATGCAGGCGTCATCGGTAGCGGCGAGTCCGTTGGGCCGGTCACCGGAG
CGGACACGCAACTACAAGACGCACCAGCCGTCGCCGCTGCGGCAAGAAGTGGATGCGAGCCAGGCGGGGCCCTCG
AGTAGAAGAAGAGAGCAACGCCGGGTCGAGCCTCGAGGGGACAGTATAGAGGTTGAGCGGCCTCTTTGGCCCAAG
CGTGGCGCGTCACCAGCCAGGGGAACTCCCGACTCGCCCTACTCGATTGTCGACGCCGAGGTGGAGCGCCAACGA
CTAGGCTACTGTGGAGGCAGCCAGGGCCAGGCGCAAGAGTATCGAGGAGTCAAGTCGTCGTCTTCCTTTTGGAAG
GGCAAGGGACGCGCCGTGGTGCCAGAGGAAGCGCAAAGGCTGACTGGCAGGAATCACGGGCTGCGCTCTCTGCGT
CCATTGGCAGAAGGCGATGCGGTGCCGGCGCTGTACGAGCTGGGCGGAGTGCCTGTAGATGACGATGAGGCGAGT
GAGCACTGGTCGGGATCTGAGCGAGCGGCGTGGAAGCGATGGATTTGCGCATGTTTTAAGTAG
Gene >OphauB2|5766
ATGGCACGACTAACCACGGATTCAAACGCCAGGTTCCAGCGTCATGTCGGCTTCGACAATGTTCCCAATGGAGAG
TTTACTAGAAATAACACGCTTTCGCTCGTTCTCAATGTTCGCCACAAGGGTTACCAAGCCAAGCGTAGGTCGCGG
ACTTTTATGGTTGGCATTGATGAAAATTCTTATTCGGATTACGCAATTCAGTGGCTTCTCGACGAGCTTGTGGAC
GATGGCGACGAAATCGTCTGCGTTCACGTTGCCGAGAAGGACCAACGATGCCAAATTGACAGCAGCAAGTACCAA
GATGATGCAAACGCCCTCATGGAGAGCATCATTGCCAAGAATGGAGCCAGCCTTGCCGTGAGCTTCATTTTGGAA
TACGCTGTGGGAAAGCTTCATGCCACCTTTCAGAAACTGGTGAGTCGATTGCATTGCCATGGATGCAAAAGAGGA
CTCTTGCTGACTACCTTTTTTTTTTGTCTTGCAGATTCAAATGTATCAACCTGCTATGCTCATTGTTGGCACTAG
AGGCAGATCCTTTGGTGGTATCCAAGGCCTTGTCAACTCGCGAAACTCGTTTTCAAAGTACTGTTTACAGTACTC
GCCGGTTCCCGTTGTTGTTGTCCGACCGACCGAGAAGCGCATCAAGAAGAAGGTTAAGCGCGCACATGATTCAAC
TCGGCAAACATATCTTGGCATGTTGGCGGCTACTAATGGGCGCCACGAGGCCGATAGCGAGTCGAGTAGTGCTTA
TGATCTCGAGATTCAAGGCACTCCAGACGAGGAGGCGCACCAGGTGGCCAAGGTGCTGGGTCTTCCTGCCAAGTA
CGACCCGACGATTAAGCCACTGGCAATTGGCTTGCTGCCACGATCGCGGCCGGCGAGCCCGTTTCAAGCGGCTCA
GGCGGCAGAGGCGCAGCGCGTCGTGGACACTTCGCCCACTAGCGCCGGGGCTGAAAGTGACTTTGACGAGGACGA
TTACGAGCCCGACTTTGACGTTATGGACGGAGGCCAGGCCCTAAATCAACAGAAAAAGCTGGAACACCTTCACGA
GATGGAGGCTGACGAGGCCGCTGCTCTGCGCAAGGGTGTCGAAGAGGTGGACGCCGATTCGGACGAAAAGTCGTC
TGAAACACAAGACCCCAATAATGCATCATAGAAGATGTGTGCTGGCCGAGGCAGGGCCTCTACTGGTGCTCCATC
TCGCCAGCCCGCCGTGGCTGGTGGTGCCTGTGTTGCTGGGTCCGGACGTAGCAATTTGGCGAGCCAACCATGGGA
CTACGACCAATGTGCTCCTTTTTGGCGGGTCTATGACGAGTCGACTGAATCCGAAACTCTTGTACCACAAAAGGA
GCAAGATGTAAAGGACGAGGTTGCGAGCAAAGCGTCGAGCGAAAGGCTCAATGTCATTGTCGAGGAGGAGTCTAG
CGACAGCGACGGCGATGACGTTGGAGACGCGGCACCTCACGAGGCAGATGGCAATCAAGAGCAGTGTGCGAGGCA
GCCGCAGGTTATGCAAGCATACACGTCTACCATGAGGACGGGAGCGGGCGCTAAAGTATACCAAGTGGATGTAGC
GGCATCTTGTACTGATGAGCGCCTCGGCAAGGCACAAGACGCTGTTGTTGCTTGTGGAAGTGATGGGACTCAAGA
AGAGGATGCGGCAACGGCTGGCGACAAGGCGCGCACTGCGATTCGAAAGATGCGAATGGAGCATGGCGAACGCAG
CAGGGAAGTCCGACGCAGAGTGGCACGGGAACAAGATTGCGTACTGAGCCAAGAAGATTATGCGGTGGAGGGGAT
TGAAGTGCGAGATTTTGCGCACCCAGAGTCTGCAGAGCTACCATCAAACTTGGTGAATCCATGGGCAACGGAAGC
AACGTGTACAGCAGATGTGTGTGCGACAAGTGTGATGTACGAGGCGCACGAGTCTGGACCCAGTGCAAACTTGAA
GGGCGGTCCATGTCCATCTGATGGAGACTTGACTGTTGCAATGGTGGCAGAGGCTGATGCAATGCCATGGGACGA
GGCATCAGGCGAGCAGGCGCCCAGTCGGTCTCAGTCTGGGCACGTCTACGATGTATCACGACAGGCGAGTCAAGC
AGAGTGGCGTACAGCAGTGGATGAGGCATTGCCGCAAACGCACGAGCAATCGCTGCAAGGACAAGAGCCAGGGGC
AAGGCACCGAGCGTCGTTGTTGCAAGATGAAGCGACAGAGGCTGAGCCACTGCTGCAGGCTGCTCCCGATTGTGC
AGAGGCTGAATACTTGCTACAAGGCGAGGCGCCGTTGCAGCAGACTTATTGGCCGTCTGATGCAGAGCCAGCATG
GTCAAATCTGCCGTGTGCTGCAGTGGAGTCGGCACGAGGGGATGGACCGCCGATGGCTGGATACTGGTCAGATCA
AGAGGCGGATGGACGGAGGCCAAGGGCAGAAGCAGCGATTTGGGCACGTTCGCCACGGGCTTTGTATCGAGGGCG
ACGAGTGCGACGACAATGGAGCAGCGACGAAGGACGTCAATGGCAGGCTGAAGCTTTGTCATTGATAGAGGAGGA
CGCGTCGATTGCTGAAGGGTTGGCGTGGGAAGCCAAGACTAGACCGCCTCGAGCACAGGGACCTCGATGGATGTC
GGGACCGTCGTTTCGCCGCGGCCACTTACATACTGGATATCGGGGTGCAGGCGGCCCGCCAGCCGTGATTCACCG
GCAGATGCAGGCGTCATCGGTAGCGGCGAGTCCGTTGGGCCGGTCACCGGAGCGGACACGCAACTACAAGACGCA
CCAGCCGTCGCCGCTGCGGCAAGAAGTGGATGCGAGCCAGGCGGGGCCCTCGAGTAGAAGAAGAGAGCAACGCCG
GGTCGAGCCTCGAGGGGACAGTATAGAGGTTGAGCGGCCTCTTTGGCCCAAGCGTGGCGCGTCACCAGCCAGGGG
AACTCCCGACTCGCCCTACTCGATTGTCGACGCCGAGGTGGAGCGCCAACGACTAGGCTACTGTGGAGGCAGCCA
GGGCCAGGCGCAAGAGTATCGAGGAGTCAAGTCGTCGTCTTCCTTTTGGAAGGGCAAGGGACGCGCCGTGGTGCC
AGAGGAAGCGCAAAGGCTGACTGGCAGGAATCACGGGCTGCGCTCTCTGCGTCCATTGGCAGAAGGCGATGCGGT
GCCGGCGCTGTACGAGCTGGGCGGAGTGCCTGTAGATGACGATGAGGCGAGTGAGCACTGGTCGGGATCTGAGCG
AGCGGCGTGGAAGCGATGGATTTGCGCATGTTTTAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail