Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5766
Gene name
LocationContig_48:24116..27381
Strand+
Gene length (bp)3265
Transcript length (bp)3138
Coding sequence length (bp)3138
Protein length (aa) 1046

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00582 Usp Universal stress protein family 9.5E-14 50 185

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74782|YGBA_SCHPO Universal stress protein A family protein C25B2.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25B2.10 PE=1 SV=1 12 210 1.0E-39
sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 45 203 2.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4060
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1263
Ophiocordyceps australis map64 (Brazil) OphauB2|5766 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05986
Ophiocordyceps camponoti-rufipedis Ophun1|5802
Ophiocordyceps kimflemingae Ophio5|751
Ophiocordyceps subramaniannii Hirsu2|8180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5766
MARLTTDSNARFQRHVGFDNVPNGEFTRNNTLSLVLNVRHKGYQAKRRSRTFMVGIDENSYSDYAIQWLLDELVD
DGDEIVCVHVAEKDQRCQIDSSKYQDDANALMESIIAKNGASLAVSFILEYAVGKLHATFQKLIQMYQPAMLIVG
TRGRSFGGIQGLVNSRNSFSKYCLQYSPVPVVVVRPTEKRIKKKVKRAHDSTRQTYLGMLAATNGRHEADSESSS
AYDLEIQGTPDEEAHQVAKVLGLPAKYDPTIKPLAIGLLPRSRPASPFQAAQAAEAQRVVDTSPTSAGAESDFDE
DDYEPDFDVMDGGQALNQQKKLEHLHEMEADEAAALRKGVEEVDADSDEKSASTGAPSRQPAVAGGACVAGSGRS
NLASQPWDYDQCAPFWRVYDESTESETLVPQKEQDVKDEVASKASSERLNVIVEEESSDSDGDDVGDAAPHEADG
NQEQCARQPQVMQAYTSTMRTGAGAKVYQVDVAASCTDERLGKAQDAVVACGSDGTQEEDAATAGDKARTAIRKM
RMEHGERSREVRRRVAREQDCVLSQEDYAVEGIEVRDFAHPESAELPSNLVNPWATEATCTADVCATSVMYEAHE
SGPSANLKGGPCPSDGDLTVAMVAEADAMPWDEASGEQAPSRSQSGHVYDVSRQASQAEWRTAVDEALPQTHEQS
LQGQEPGARHRASLLQDEATEAEPLLQAAPDCAEAEYLLQGEAPLQQTYWPSDAEPAWSNLPCAAVESARGDGPP
MAGYWSDQEADGRRPRAEAAIWARSPRALYRGRRVRRQWSSDEGRQWQAEALSLIEEDASIAEGLAWEAKTRPPR
AQGPRWMSGPSFRRGHLHTGYRGAGGPPAVIHRQMQASSVAASPLGRSPERTRNYKTHQPSPLRQEVDASQAGPS
SRRREQRRVEPRGDSIEVERPLWPKRGASPARGTPDSPYSIVDAEVERQRLGYCGGSQGQAQEYRGVKSSSSFWK
GKGRAVVPEEAQRLTGRNHGLRSLRPLAEGDAVPALYELGGVPVDDDEASEHWSGSERAAWKRWICACFK*
Coding >OphauB2|5766
ATGGCACGACTAACCACGGATTCAAACGCCAGGTTCCAGCGTCATGTCGGCTTCGACAATGTTCCCAATGGAGAG
TTTACTAGAAATAACACGCTTTCGCTCGTTCTCAATGTTCGCCACAAGGGTTACCAAGCCAAGCGTAGGTCGCGG
ACTTTTATGGTTGGCATTGATGAAAATTCTTATTCGGATTACGCAATTCAGTGGCTTCTCGACGAGCTTGTGGAC
GATGGCGACGAAATCGTCTGCGTTCACGTTGCCGAGAAGGACCAACGATGCCAAATTGACAGCAGCAAGTACCAA
GATGATGCAAACGCCCTCATGGAGAGCATCATTGCCAAGAATGGAGCCAGCCTTGCCGTGAGCTTCATTTTGGAA
TACGCTGTGGGAAAGCTTCATGCCACCTTTCAGAAACTGATTCAAATGTATCAACCTGCTATGCTCATTGTTGGC
ACTAGAGGCAGATCCTTTGGTGGTATCCAAGGCCTTGTCAACTCGCGAAACTCGTTTTCAAAGTACTGTTTACAG
TACTCGCCGGTTCCCGTTGTTGTTGTCCGACCGACCGAGAAGCGCATCAAGAAGAAGGTTAAGCGCGCACATGAT
TCAACTCGGCAAACATATCTTGGCATGTTGGCGGCTACTAATGGGCGCCACGAGGCCGATAGCGAGTCGAGTAGT
GCTTATGATCTCGAGATTCAAGGCACTCCAGACGAGGAGGCGCACCAGGTGGCCAAGGTGCTGGGTCTTCCTGCC
AAGTACGACCCGACGATTAAGCCACTGGCAATTGGCTTGCTGCCACGATCGCGGCCGGCGAGCCCGTTTCAAGCG
GCTCAGGCGGCAGAGGCGCAGCGCGTCGTGGACACTTCGCCCACTAGCGCCGGGGCTGAAAGTGACTTTGACGAG
GACGATTACGAGCCCGACTTTGACGTTATGGACGGAGGCCAGGCCCTAAATCAACAGAAAAAGCTGGAACACCTT
CACGAGATGGAGGCTGACGAGGCCGCTGCTCTGCGCAAGGGTGTCGAAGAGGTGGACGCCGATTCGGACGAAAAG
TCGGCCTCTACTGGTGCTCCATCTCGCCAGCCCGCCGTGGCTGGTGGTGCCTGTGTTGCTGGGTCCGGACGTAGC
AATTTGGCGAGCCAACCATGGGACTACGACCAATGTGCTCCTTTTTGGCGGGTCTATGACGAGTCGACTGAATCC
GAAACTCTTGTACCACAAAAGGAGCAAGATGTAAAGGACGAGGTTGCGAGCAAAGCGTCGAGCGAAAGGCTCAAT
GTCATTGTCGAGGAGGAGTCTAGCGACAGCGACGGCGATGACGTTGGAGACGCGGCACCTCACGAGGCAGATGGC
AATCAAGAGCAGTGTGCGAGGCAGCCGCAGGTTATGCAAGCATACACGTCTACCATGAGGACGGGAGCGGGCGCT
AAAGTATACCAAGTGGATGTAGCGGCATCTTGTACTGATGAGCGCCTCGGCAAGGCACAAGACGCTGTTGTTGCT
TGTGGAAGTGATGGGACTCAAGAAGAGGATGCGGCAACGGCTGGCGACAAGGCGCGCACTGCGATTCGAAAGATG
CGAATGGAGCATGGCGAACGCAGCAGGGAAGTCCGACGCAGAGTGGCACGGGAACAAGATTGCGTACTGAGCCAA
GAAGATTATGCGGTGGAGGGGATTGAAGTGCGAGATTTTGCGCACCCAGAGTCTGCAGAGCTACCATCAAACTTG
GTGAATCCATGGGCAACGGAAGCAACGTGTACAGCAGATGTGTGTGCGACAAGTGTGATGTACGAGGCGCACGAG
TCTGGACCCAGTGCAAACTTGAAGGGCGGTCCATGTCCATCTGATGGAGACTTGACTGTTGCAATGGTGGCAGAG
GCTGATGCAATGCCATGGGACGAGGCATCAGGCGAGCAGGCGCCCAGTCGGTCTCAGTCTGGGCACGTCTACGAT
GTATCACGACAGGCGAGTCAAGCAGAGTGGCGTACAGCAGTGGATGAGGCATTGCCGCAAACGCACGAGCAATCG
CTGCAAGGACAAGAGCCAGGGGCAAGGCACCGAGCGTCGTTGTTGCAAGATGAAGCGACAGAGGCTGAGCCACTG
CTGCAGGCTGCTCCCGATTGTGCAGAGGCTGAATACTTGCTACAAGGCGAGGCGCCGTTGCAGCAGACTTATTGG
CCGTCTGATGCAGAGCCAGCATGGTCAAATCTGCCGTGTGCTGCAGTGGAGTCGGCACGAGGGGATGGACCGCCG
ATGGCTGGATACTGGTCAGATCAAGAGGCGGATGGACGGAGGCCAAGGGCAGAAGCAGCGATTTGGGCACGTTCG
CCACGGGCTTTGTATCGAGGGCGACGAGTGCGACGACAATGGAGCAGCGACGAAGGACGTCAATGGCAGGCTGAA
GCTTTGTCATTGATAGAGGAGGACGCGTCGATTGCTGAAGGGTTGGCGTGGGAAGCCAAGACTAGACCGCCTCGA
GCACAGGGACCTCGATGGATGTCGGGACCGTCGTTTCGCCGCGGCCACTTACATACTGGATATCGGGGTGCAGGC
GGCCCGCCAGCCGTGATTCACCGGCAGATGCAGGCGTCATCGGTAGCGGCGAGTCCGTTGGGCCGGTCACCGGAG
CGGACACGCAACTACAAGACGCACCAGCCGTCGCCGCTGCGGCAAGAAGTGGATGCGAGCCAGGCGGGGCCCTCG
AGTAGAAGAAGAGAGCAACGCCGGGTCGAGCCTCGAGGGGACAGTATAGAGGTTGAGCGGCCTCTTTGGCCCAAG
CGTGGCGCGTCACCAGCCAGGGGAACTCCCGACTCGCCCTACTCGATTGTCGACGCCGAGGTGGAGCGCCAACGA
CTAGGCTACTGTGGAGGCAGCCAGGGCCAGGCGCAAGAGTATCGAGGAGTCAAGTCGTCGTCTTCCTTTTGGAAG
GGCAAGGGACGCGCCGTGGTGCCAGAGGAAGCGCAAAGGCTGACTGGCAGGAATCACGGGCTGCGCTCTCTGCGT
CCATTGGCAGAAGGCGATGCGGTGCCGGCGCTGTACGAGCTGGGCGGAGTGCCTGTAGATGACGATGAGGCGAGT
GAGCACTGGTCGGGATCTGAGCGAGCGGCGTGGAAGCGATGGATTTGCGCATGTTTTAAGTAG
Transcript >OphauB2|5766
ATGGCACGACTAACCACGGATTCAAACGCCAGGTTCCAGCGTCATGTCGGCTTCGACAATGTTCCCAATGGAGAG
TTTACTAGAAATAACACGCTTTCGCTCGTTCTCAATGTTCGCCACAAGGGTTACCAAGCCAAGCGTAGGTCGCGG
ACTTTTATGGTTGGCATTGATGAAAATTCTTATTCGGATTACGCAATTCAGTGGCTTCTCGACGAGCTTGTGGAC
GATGGCGACGAAATCGTCTGCGTTCACGTTGCCGAGAAGGACCAACGATGCCAAATTGACAGCAGCAAGTACCAA
GATGATGCAAACGCCCTCATGGAGAGCATCATTGCCAAGAATGGAGCCAGCCTTGCCGTGAGCTTCATTTTGGAA
TACGCTGTGGGAAAGCTTCATGCCACCTTTCAGAAACTGATTCAAATGTATCAACCTGCTATGCTCATTGTTGGC
ACTAGAGGCAGATCCTTTGGTGGTATCCAAGGCCTTGTCAACTCGCGAAACTCGTTTTCAAAGTACTGTTTACAG
TACTCGCCGGTTCCCGTTGTTGTTGTCCGACCGACCGAGAAGCGCATCAAGAAGAAGGTTAAGCGCGCACATGAT
TCAACTCGGCAAACATATCTTGGCATGTTGGCGGCTACTAATGGGCGCCACGAGGCCGATAGCGAGTCGAGTAGT
GCTTATGATCTCGAGATTCAAGGCACTCCAGACGAGGAGGCGCACCAGGTGGCCAAGGTGCTGGGTCTTCCTGCC
AAGTACGACCCGACGATTAAGCCACTGGCAATTGGCTTGCTGCCACGATCGCGGCCGGCGAGCCCGTTTCAAGCG
GCTCAGGCGGCAGAGGCGCAGCGCGTCGTGGACACTTCGCCCACTAGCGCCGGGGCTGAAAGTGACTTTGACGAG
GACGATTACGAGCCCGACTTTGACGTTATGGACGGAGGCCAGGCCCTAAATCAACAGAAAAAGCTGGAACACCTT
CACGAGATGGAGGCTGACGAGGCCGCTGCTCTGCGCAAGGGTGTCGAAGAGGTGGACGCCGATTCGGACGAAAAG
TCGGCCTCTACTGGTGCTCCATCTCGCCAGCCCGCCGTGGCTGGTGGTGCCTGTGTTGCTGGGTCCGGACGTAGC
AATTTGGCGAGCCAACCATGGGACTACGACCAATGTGCTCCTTTTTGGCGGGTCTATGACGAGTCGACTGAATCC
GAAACTCTTGTACCACAAAAGGAGCAAGATGTAAAGGACGAGGTTGCGAGCAAAGCGTCGAGCGAAAGGCTCAAT
GTCATTGTCGAGGAGGAGTCTAGCGACAGCGACGGCGATGACGTTGGAGACGCGGCACCTCACGAGGCAGATGGC
AATCAAGAGCAGTGTGCGAGGCAGCCGCAGGTTATGCAAGCATACACGTCTACCATGAGGACGGGAGCGGGCGCT
AAAGTATACCAAGTGGATGTAGCGGCATCTTGTACTGATGAGCGCCTCGGCAAGGCACAAGACGCTGTTGTTGCT
TGTGGAAGTGATGGGACTCAAGAAGAGGATGCGGCAACGGCTGGCGACAAGGCGCGCACTGCGATTCGAAAGATG
CGAATGGAGCATGGCGAACGCAGCAGGGAAGTCCGACGCAGAGTGGCACGGGAACAAGATTGCGTACTGAGCCAA
GAAGATTATGCGGTGGAGGGGATTGAAGTGCGAGATTTTGCGCACCCAGAGTCTGCAGAGCTACCATCAAACTTG
GTGAATCCATGGGCAACGGAAGCAACGTGTACAGCAGATGTGTGTGCGACAAGTGTGATGTACGAGGCGCACGAG
TCTGGACCCAGTGCAAACTTGAAGGGCGGTCCATGTCCATCTGATGGAGACTTGACTGTTGCAATGGTGGCAGAG
GCTGATGCAATGCCATGGGACGAGGCATCAGGCGAGCAGGCGCCCAGTCGGTCTCAGTCTGGGCACGTCTACGAT
GTATCACGACAGGCGAGTCAAGCAGAGTGGCGTACAGCAGTGGATGAGGCATTGCCGCAAACGCACGAGCAATCG
CTGCAAGGACAAGAGCCAGGGGCAAGGCACCGAGCGTCGTTGTTGCAAGATGAAGCGACAGAGGCTGAGCCACTG
CTGCAGGCTGCTCCCGATTGTGCAGAGGCTGAATACTTGCTACAAGGCGAGGCGCCGTTGCAGCAGACTTATTGG
CCGTCTGATGCAGAGCCAGCATGGTCAAATCTGCCGTGTGCTGCAGTGGAGTCGGCACGAGGGGATGGACCGCCG
ATGGCTGGATACTGGTCAGATCAAGAGGCGGATGGACGGAGGCCAAGGGCAGAAGCAGCGATTTGGGCACGTTCG
CCACGGGCTTTGTATCGAGGGCGACGAGTGCGACGACAATGGAGCAGCGACGAAGGACGTCAATGGCAGGCTGAA
GCTTTGTCATTGATAGAGGAGGACGCGTCGATTGCTGAAGGGTTGGCGTGGGAAGCCAAGACTAGACCGCCTCGA
GCACAGGGACCTCGATGGATGTCGGGACCGTCGTTTCGCCGCGGCCACTTACATACTGGATATCGGGGTGCAGGC
GGCCCGCCAGCCGTGATTCACCGGCAGATGCAGGCGTCATCGGTAGCGGCGAGTCCGTTGGGCCGGTCACCGGAG
CGGACACGCAACTACAAGACGCACCAGCCGTCGCCGCTGCGGCAAGAAGTGGATGCGAGCCAGGCGGGGCCCTCG
AGTAGAAGAAGAGAGCAACGCCGGGTCGAGCCTCGAGGGGACAGTATAGAGGTTGAGCGGCCTCTTTGGCCCAAG
CGTGGCGCGTCACCAGCCAGGGGAACTCCCGACTCGCCCTACTCGATTGTCGACGCCGAGGTGGAGCGCCAACGA
CTAGGCTACTGTGGAGGCAGCCAGGGCCAGGCGCAAGAGTATCGAGGAGTCAAGTCGTCGTCTTCCTTTTGGAAG
GGCAAGGGACGCGCCGTGGTGCCAGAGGAAGCGCAAAGGCTGACTGGCAGGAATCACGGGCTGCGCTCTCTGCGT
CCATTGGCAGAAGGCGATGCGGTGCCGGCGCTGTACGAGCTGGGCGGAGTGCCTGTAGATGACGATGAGGCGAGT
GAGCACTGGTCGGGATCTGAGCGAGCGGCGTGGAAGCGATGGATTTGCGCATGTTTTAAGTAG
Gene >OphauB2|5766
ATGGCACGACTAACCACGGATTCAAACGCCAGGTTCCAGCGTCATGTCGGCTTCGACAATGTTCCCAATGGAGAG
TTTACTAGAAATAACACGCTTTCGCTCGTTCTCAATGTTCGCCACAAGGGTTACCAAGCCAAGCGTAGGTCGCGG
ACTTTTATGGTTGGCATTGATGAAAATTCTTATTCGGATTACGCAATTCAGTGGCTTCTCGACGAGCTTGTGGAC
GATGGCGACGAAATCGTCTGCGTTCACGTTGCCGAGAAGGACCAACGATGCCAAATTGACAGCAGCAAGTACCAA
GATGATGCAAACGCCCTCATGGAGAGCATCATTGCCAAGAATGGAGCCAGCCTTGCCGTGAGCTTCATTTTGGAA
TACGCTGTGGGAAAGCTTCATGCCACCTTTCAGAAACTGGTGAGTCGATTGCATTGCCATGGATGCAAAAGAGGA
CTCTTGCTGACTACCTTTTTTTTTTGTCTTGCAGATTCAAATGTATCAACCTGCTATGCTCATTGTTGGCACTAG
AGGCAGATCCTTTGGTGGTATCCAAGGCCTTGTCAACTCGCGAAACTCGTTTTCAAAGTACTGTTTACAGTACTC
GCCGGTTCCCGTTGTTGTTGTCCGACCGACCGAGAAGCGCATCAAGAAGAAGGTTAAGCGCGCACATGATTCAAC
TCGGCAAACATATCTTGGCATGTTGGCGGCTACTAATGGGCGCCACGAGGCCGATAGCGAGTCGAGTAGTGCTTA
TGATCTCGAGATTCAAGGCACTCCAGACGAGGAGGCGCACCAGGTGGCCAAGGTGCTGGGTCTTCCTGCCAAGTA
CGACCCGACGATTAAGCCACTGGCAATTGGCTTGCTGCCACGATCGCGGCCGGCGAGCCCGTTTCAAGCGGCTCA
GGCGGCAGAGGCGCAGCGCGTCGTGGACACTTCGCCCACTAGCGCCGGGGCTGAAAGTGACTTTGACGAGGACGA
TTACGAGCCCGACTTTGACGTTATGGACGGAGGCCAGGCCCTAAATCAACAGAAAAAGCTGGAACACCTTCACGA
GATGGAGGCTGACGAGGCCGCTGCTCTGCGCAAGGGTGTCGAAGAGGTGGACGCCGATTCGGACGAAAAGTCGTC
TGAAACACAAGACCCCAATAATGCATCATAGAAGATGTGTGCTGGCCGAGGCAGGGCCTCTACTGGTGCTCCATC
TCGCCAGCCCGCCGTGGCTGGTGGTGCCTGTGTTGCTGGGTCCGGACGTAGCAATTTGGCGAGCCAACCATGGGA
CTACGACCAATGTGCTCCTTTTTGGCGGGTCTATGACGAGTCGACTGAATCCGAAACTCTTGTACCACAAAAGGA
GCAAGATGTAAAGGACGAGGTTGCGAGCAAAGCGTCGAGCGAAAGGCTCAATGTCATTGTCGAGGAGGAGTCTAG
CGACAGCGACGGCGATGACGTTGGAGACGCGGCACCTCACGAGGCAGATGGCAATCAAGAGCAGTGTGCGAGGCA
GCCGCAGGTTATGCAAGCATACACGTCTACCATGAGGACGGGAGCGGGCGCTAAAGTATACCAAGTGGATGTAGC
GGCATCTTGTACTGATGAGCGCCTCGGCAAGGCACAAGACGCTGTTGTTGCTTGTGGAAGTGATGGGACTCAAGA
AGAGGATGCGGCAACGGCTGGCGACAAGGCGCGCACTGCGATTCGAAAGATGCGAATGGAGCATGGCGAACGCAG
CAGGGAAGTCCGACGCAGAGTGGCACGGGAACAAGATTGCGTACTGAGCCAAGAAGATTATGCGGTGGAGGGGAT
TGAAGTGCGAGATTTTGCGCACCCAGAGTCTGCAGAGCTACCATCAAACTTGGTGAATCCATGGGCAACGGAAGC
AACGTGTACAGCAGATGTGTGTGCGACAAGTGTGATGTACGAGGCGCACGAGTCTGGACCCAGTGCAAACTTGAA
GGGCGGTCCATGTCCATCTGATGGAGACTTGACTGTTGCAATGGTGGCAGAGGCTGATGCAATGCCATGGGACGA
GGCATCAGGCGAGCAGGCGCCCAGTCGGTCTCAGTCTGGGCACGTCTACGATGTATCACGACAGGCGAGTCAAGC
AGAGTGGCGTACAGCAGTGGATGAGGCATTGCCGCAAACGCACGAGCAATCGCTGCAAGGACAAGAGCCAGGGGC
AAGGCACCGAGCGTCGTTGTTGCAAGATGAAGCGACAGAGGCTGAGCCACTGCTGCAGGCTGCTCCCGATTGTGC
AGAGGCTGAATACTTGCTACAAGGCGAGGCGCCGTTGCAGCAGACTTATTGGCCGTCTGATGCAGAGCCAGCATG
GTCAAATCTGCCGTGTGCTGCAGTGGAGTCGGCACGAGGGGATGGACCGCCGATGGCTGGATACTGGTCAGATCA
AGAGGCGGATGGACGGAGGCCAAGGGCAGAAGCAGCGATTTGGGCACGTTCGCCACGGGCTTTGTATCGAGGGCG
ACGAGTGCGACGACAATGGAGCAGCGACGAAGGACGTCAATGGCAGGCTGAAGCTTTGTCATTGATAGAGGAGGA
CGCGTCGATTGCTGAAGGGTTGGCGTGGGAAGCCAAGACTAGACCGCCTCGAGCACAGGGACCTCGATGGATGTC
GGGACCGTCGTTTCGCCGCGGCCACTTACATACTGGATATCGGGGTGCAGGCGGCCCGCCAGCCGTGATTCACCG
GCAGATGCAGGCGTCATCGGTAGCGGCGAGTCCGTTGGGCCGGTCACCGGAGCGGACACGCAACTACAAGACGCA
CCAGCCGTCGCCGCTGCGGCAAGAAGTGGATGCGAGCCAGGCGGGGCCCTCGAGTAGAAGAAGAGAGCAACGCCG
GGTCGAGCCTCGAGGGGACAGTATAGAGGTTGAGCGGCCTCTTTGGCCCAAGCGTGGCGCGTCACCAGCCAGGGG
AACTCCCGACTCGCCCTACTCGATTGTCGACGCCGAGGTGGAGCGCCAACGACTAGGCTACTGTGGAGGCAGCCA
GGGCCAGGCGCAAGAGTATCGAGGAGTCAAGTCGTCGTCTTCCTTTTGGAAGGGCAAGGGACGCGCCGTGGTGCC
AGAGGAAGCGCAAAGGCTGACTGGCAGGAATCACGGGCTGCGCTCTCTGCGTCCATTGGCAGAAGGCGATGCGGT
GCCGGCGCTGTACGAGCTGGGCGGAGTGCCTGTAGATGACGATGAGGCGAGTGAGCACTGGTCGGGATCTGAGCG
AGCGGCGTGGAAGCGATGGATTTGCGCATGTTTTAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail