Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|576
Gene name
LocationContig_11:135229..136504
Strand+
Gene length (bp)1275
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07281 INSIG Insulin-induced protein (INSIG) 6.5E-80 152 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53898|NSG2_YEAST Protein NSG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSG2 PE=1 SV=1 196 295 8.0E-08
sp|B0CMA4|INSI2_CALJA Insulin-induced gene 2 protein OS=Callithrix jacchus GN=INSIG2 PE=3 SV=1 197 296 3.0E-06
sp|Q66J27|INSI2_XENLA Insulin-induced gene 2 protein OS=Xenopus laevis GN=insig2 PE=2 SV=1 197 287 3.0E-06
sp|Q5U4Q2|INSI2_XENTR Insulin-induced gene 2 protein OS=Xenopus tropicalis GN=insig2 PE=2 SV=1 197 287 7.0E-06
sp|A9RA88|INSI2_PAPAN Insulin-induced gene 2 protein OS=Papio anubis GN=INSIG2 PE=3 SV=1 197 300 7.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53898|NSG2_YEAST Protein NSG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSG2 PE=1 SV=1 196 295 8.0E-08
sp|B0CMA4|INSI2_CALJA Insulin-induced gene 2 protein OS=Callithrix jacchus GN=INSIG2 PE=3 SV=1 197 296 3.0E-06
sp|Q66J27|INSI2_XENLA Insulin-induced gene 2 protein OS=Xenopus laevis GN=insig2 PE=2 SV=1 197 287 3.0E-06
sp|Q5U4Q2|INSI2_XENTR Insulin-induced gene 2 protein OS=Xenopus tropicalis GN=insig2 PE=2 SV=1 197 287 7.0E-06
sp|A9RA88|INSI2_PAPAN Insulin-induced gene 2 protein OS=Papio anubis GN=INSIG2 PE=3 SV=1 197 300 7.0E-06
sp|Q6PQZ3|INSI2_PIG Insulin-induced gene 2 protein OS=Sus scrofa GN=INSIG2 PE=2 SV=2 197 300 8.0E-06
sp|Q9Y5U4|INSI2_HUMAN Insulin-induced gene 2 protein OS=Homo sapiens GN=INSIG2 PE=1 SV=2 197 296 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 258 280 22
2 287 309 22
3 365 387 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|576
MADLDNGPHIVRPIARRPFGLSLDSGTGCDGGCPHEQNSQTPPSPLQQESLLAPPLETLSRPQSILNLTSSTLMG
IYSQAAAANPPSRDELVTDTPWGTGAQTPVRRSGIDDATYQLMRDRAHSRRQRRRATSTPGTRAGLGPSALDTAS
SLALLFVLGCGYGALVGTLHGDEQQEAQLGGYYIRPGLNWRYLTFWGAAGALLGSSLPWLDRVWERALGDEADLY
ASAKESDLGTDWTLVMRAVGAFVGIVFAIRKLAWASTLQVSATLALVNPLLWWLIDRSKPGLVLSAVVGLAGSML
LLGVCPQMMPAPTRSPMASPMSASPSPSAIVAPTNGSSPEAPPGQGPSWTMLGGLASQETLERGVWIVSVLFCSC
ICFGNIGRRLAWRRGASGKGRWGWVR*
Coding >OphauB2|576
ATGGCCGACTTGGACAATGGGCCGCATATTGTGCGCCCGATTGCACGCCGTCCCTTTGGCCTCAGCCTCGACAGC
GGCACTGGCTGTGATGGCGGCTGTCCCCATGAGCAAAACAGCCAGACGCCGCCGTCGCCGCTGCAGCAAGAGAGC
TTGTTGGCTCCGCCGCTGGAAACACTGAGTCGCCCGCAGTCGATTCTCAACCTCACCTCGTCGACGCTCATGGGC
ATCTATTCACAAGCGGCGGCTGCAAACCCGCCCTCGCGCGACGAGCTCGTGACTGATACGCCCTGGGGCACGGGC
GCGCAGACGCCGGTGCGTCGCTCAGGCATCGACGACGCGACTTATCAGCTGATGCGTGACCGGGCGCATAGTCGG
CGCCAGCGCAGACGCGCCACGTCGACGCCCGGGACTCGCGCCGGGCTGGGCCCCTCTGCTCTCGACACGGCATCC
TCATTGGCCTTGCTCTTTGTGCTGGGCTGTGGATATGGCGCGCTCGTCGGCACGCTGCATGGCGACGAGCAGCAA
GAGGCGCAGCTGGGGGGCTATTATATCCGGCCGGGGCTCAACTGGCGCTACCTGACGTTTTGGGGTGCCGCCGGC
GCTCTGCTGGGCTCGTCGCTGCCCTGGCTAGACCGCGTGTGGGAGAGGGCGCTTGGCGACGAGGCCGACTTGTAT
GCCAGTGCCAAGGAGAGCGACCTGGGCACCGACTGGACCTTGGTTATGCGGGCGGTTGGGGCCTTTGTCGGAATA
GTCTTTGCCATTCGCAAGCTTGCCTGGGCGTCGACGCTGCAAGTCTCTGCCACTCTAGCTCTCGTTAACCCCCTG
CTCTGGTGGCTTATCGACCGCAGCAAGCCCGGCCTCGTGCTCTCGGCTGTTGTTGGCCTGGCAGGATCCATGCTT
CTTCTCGGCGTCTGTCCGCAAATGATGCCGGCGCCAACGCGGTCGCCCATGGCGTCGCCCATGTCGGCTTCGCCC
TCGCCGTCGGCCATTGTGGCGCCCACCAACGGCTCGTCACCCGAGGCGCCGCCAGGACAGGGTCCGTCGTGGACC
ATGCTAGGCGGTCTGGCTAGCCAGGAGACGCTGGAAAGGGGCGTTTGGATAGTGAGCGTCTTGTTCTGCAGCTGC
ATCTGCTTTGGCAACATTGGACGCCGACTGGCATGGCGGCGCGGCGCCTCGGGCAAGGGGCGCTGGGGCTGGGTG
CGATGA
Transcript >OphauB2|576
ATGGCCGACTTGGACAATGGGCCGCATATTGTGCGCCCGATTGCACGCCGTCCCTTTGGCCTCAGCCTCGACAGC
GGCACTGGCTGTGATGGCGGCTGTCCCCATGAGCAAAACAGCCAGACGCCGCCGTCGCCGCTGCAGCAAGAGAGC
TTGTTGGCTCCGCCGCTGGAAACACTGAGTCGCCCGCAGTCGATTCTCAACCTCACCTCGTCGACGCTCATGGGC
ATCTATTCACAAGCGGCGGCTGCAAACCCGCCCTCGCGCGACGAGCTCGTGACTGATACGCCCTGGGGCACGGGC
GCGCAGACGCCGGTGCGTCGCTCAGGCATCGACGACGCGACTTATCAGCTGATGCGTGACCGGGCGCATAGTCGG
CGCCAGCGCAGACGCGCCACGTCGACGCCCGGGACTCGCGCCGGGCTGGGCCCCTCTGCTCTCGACACGGCATCC
TCATTGGCCTTGCTCTTTGTGCTGGGCTGTGGATATGGCGCGCTCGTCGGCACGCTGCATGGCGACGAGCAGCAA
GAGGCGCAGCTGGGGGGCTATTATATCCGGCCGGGGCTCAACTGGCGCTACCTGACGTTTTGGGGTGCCGCCGGC
GCTCTGCTGGGCTCGTCGCTGCCCTGGCTAGACCGCGTGTGGGAGAGGGCGCTTGGCGACGAGGCCGACTTGTAT
GCCAGTGCCAAGGAGAGCGACCTGGGCACCGACTGGACCTTGGTTATGCGGGCGGTTGGGGCCTTTGTCGGAATA
GTCTTTGCCATTCGCAAGCTTGCCTGGGCGTCGACGCTGCAAGTCTCTGCCACTCTAGCTCTCGTTAACCCCCTG
CTCTGGTGGCTTATCGACCGCAGCAAGCCCGGCCTCGTGCTCTCGGCTGTTGTTGGCCTGGCAGGATCCATGCTT
CTTCTCGGCGTCTGTCCGCAAATGATGCCGGCGCCAACGCGGTCGCCCATGGCGTCGCCCATGTCGGCTTCGCCC
TCGCCGTCGGCCATTGTGGCGCCCACCAACGGCTCGTCACCCGAGGCGCCGCCAGGACAGGGTCCGTCGTGGACC
ATGCTAGGCGGTCTGGCTAGCCAGGAGACGCTGGAAAGGGGCGTTTGGATAGTGAGCGTCTTGTTCTGCAGCTGC
ATCTGCTTTGGCAACATTGGACGCCGACTGGCATGGCGGCGCGGCGCCTCGGGCAAGGGGCGCTGGGGCTGGGTG
CGATGA
Gene >OphauB2|576
ATGGCCGACTTGGACAATGGGCCGCATATTGTGCGCCCGATTGCACGCCGTCCCTTTGGCCTCAGCCTCGACAGC
GGCACTGGCTGTGATGGCGGCTGTCCCCATGAGCAAAACAGCCAGACGCCGCCGTCGCCGCTGCAGCAAGAGAGC
TTGTTGGCTCCGCCGCTGGAAACACTGAGTCGCCCGCAGTCGATTCTCAACCTCACCTCGTCGACGCTCATGGGC
ATCTATTCACAAGCGGCGGCTGCAAACCCGCCCTCGCGCGACGAGCTCGTGACTGATACGCCCTGGGGCACGGGC
GCGCAGACGCCGGTGCGTCGCTCAGGCATCGACGACGCGACTTATCAGCTGATGCGTGACCGGGCGCATAGTCGG
CGCCAGCGCAGACGCGCCACGTCGACGCCCGGGACTCGCGCCGGGCTGGGCCCCTCTGCTCTCGACACGGCATCC
TCATTGGCCTTGCTCTTTGTGCTGGGCTGTGGATATGGCGCGCTCGTCGGCACGCTGCATGGCGACGAGCAGCAA
GAGGCGCAGCTGGGGGGCTATTATATCCGGCCGGGGCTCAACTGGCGCTACCTGACGTTTTGGGGTGCCGCCGGC
GCTCTGCTGGGCTCGTCGCTGCCCTGGCTAGACCGCGTGTGGGAGAGGGCGCTTGGCGACGAGGCCGACTTGTAT
GCCAGTGCCAAGGAGAGCGACCTGGGCACCGACTGGACCTTGGTTATGCGGGCGGTTGGGGCCTTTGTCGGAATA
GTCTTTGCCATTGTAAGTGCCATCCATTACCCATGCATGGCTGAGTCTGGCGTGGCGCTAACCTGGAGAGTACCT
AAACAGCGCAAGCTTGCCTGGGCGTCGACGCTGCAAGTCTCTGCCACTCTAGCTCTCGTTAACCCCCTGCTCTGG
TGGCTTATCGACCGCAGCAAGCCCGGCCTCGTGCTCTCGGCTGTTGTTGGCCTGGCAGGATCCATGCTTCTTCTC
GGCGTCTGTCCGCAAATGATGCCGGCGCCAACGCGGTCGCCCATGGCGTCGCCCATGTCGGCTTCGCCCTCGCCG
TCGGCCATTGTGGCGCCCACCAACGGCTCGTCACCCGAGGCGCCGCCAGGACAGGGTCCGTCGTGGACCATGCTA
GGCGGTCTGGCTAGCCAGGAGACGCTGGAAAGGGGCGTTTGGATAGTGAGCGTCTTGTTCTGCAGCTGCATCTGC
TTTGGCAACATTGGACGCCGACTGGCATGGCGGCGCGGCGCCTCGGGCAAGGGGCGCTGGGGCTGGGTGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail