Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5758
Gene name
LocationContig_479:1527..1875
Strand-
Gene length (bp)348
Transcript length (bp)228
Coding sequence length (bp)228
Protein length (aa) 76

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05493 ATP_synt_H ATP synthase subunit H 2.4E-24 6 66

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q75EU0|VA0E_ASHGO V-type proton ATPase subunit e OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA9 PE=3 SV=1 5 74 4.0E-19
sp|Q3E7B6|VA0E_YEAST V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 1 74 4.0E-19
sp|Q69Z14|VA0E_SCHPO V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma9 PE=3 SV=2 14 65 6.0E-13
sp|Q5K8S8|VA0E_CRYNJ V-type proton ATPase subunit e OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA9 PE=3 SV=2 20 72 1.0E-11

GO

GO Term Description Terminal node
GO:0033179 proton-transporting V-type ATPase, V0 domain Yes
GO:1902600 proton transmembrane transport Yes
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0051179 localization No
GO:0015075 ion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0006812 cation transport No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0006811 ion transport No
GO:0022804 active transmembrane transporter activity No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0015399 primary active transmembrane transporter activity No
GO:0034220 ion transmembrane transport No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0140657 ATP-dependent activity No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:0055085 transmembrane transport No
GO:0005215 transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0042626 ATPase-coupled transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 33 55 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5758
MAKGYSIFVGLVVVGILCLASWFLAPKGENRVLWRSSLILSIVSCFLMWAITFLAQLHPLIVPRRSDLRESFLET
*
Coding >OphauB2|5758
ATGGCTAAAGGATACTCTATTTTCGTCGGCCTCGTCGTCGTCGGCATCCTATGCTTGGCTTCTTGGTTTCTAGCA
CCAAAGGGGGAGAATCGAGTACTTTGGCGATCGTCTCTGATTCTCTCGATCGTCAGTTGCTTTCTCATGTGGGCC
ATCACTTTCCTCGCGCAGCTCCATCCCTTAATCGTACCGAGACGAAGCGACCTGCGCGAGAGCTTCCTGGAGACA
TGA
Transcript >OphauB2|5758
ATGGCTAAAGGATACTCTATTTTCGTCGGCCTCGTCGTCGTCGGCATCCTATGCTTGGCTTCTTGGTTTCTAGCA
CCAAAGGGGGAGAATCGAGTACTTTGGCGATCGTCTCTGATTCTCTCGATCGTCAGTTGCTTTCTCATGTGGGCC
ATCACTTTCCTCGCGCAGCTCCATCCCTTAATCGTACCGAGACGAAGCGACCTGCGCGAGAGCTTCCTGGAGACA
TGA
Gene >OphauB2|5758
ATGGCTAAAGGGTAAGTCGCTATAATTGCACTAAATTGCAATCGGAATTAATCATTCTCACATATCTGAAGATAC
TCTATTTTCGTCGGCCTCGTCGTCGTCGGCATCCTATGCTTGGCTTCTTGGTTTCTAGCACCAAAGGGGGAGAAT
CGAGTGTACGTCAGGCTTCTTTATTTGCTGAGATGTGCCTCGTTGACTTCGAATTAACTTTACAGACTTTGGCGA
TCGTCTCTGATTCTCTCGATCGTCAGTTGCTTTCTCATGTGGGCCATCACTTTCCTCGCGCAGCTCCATCCCTTA
ATCGTACCGAGACGAAGCGACCTGCGCGAGAGCTTCCTGGAGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail