Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5748
Gene name
LocationContig_47:117014..118703
Strand-
Gene length (bp)1689
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.7E-07 228 276

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6C9I6|TAY1_YARLI telomere-associated protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAY1 PE=1 SV=1 226 425 2.0E-23
sp|Q10274|TEB1_SCHPO Telobox protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=teb1 PE=1 SV=1 223 425 6.0E-21
sp|Q9FJW5|TRB2_ARATH Telomere repeat-binding factor 2 OS=Arabidopsis thaliana GN=TRB2 PE=1 SV=1 227 288 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5748
MATIEPRLIHLLNEPTTPQLNHADLPPLYSLPLPASTERPLPPLEPDTSHRSTLDGTCFTFAPPALSSDESTSRK
DDARLEWRNPSAPIAHSLRLLLGDGDAPEPSLAYAKILNDSSDTCDESHSKKRARTVCGKDDFVQLPQPVKKQKA
AQQAPPMPPIINGLHEPPPQATLFPPISSESFGTNHGTSNMKFLSDVSRSANDKANTPTSSDADRNANKARKRAV
KPRRKWSEQETKHLLLGVNRHGVGKWTTILDDADFTFNARTAGDLKDRFRTCCPDELRGPSKKMPRPASPPHQPR
QSKPRAKKGIHSENILIEENNPSPPDSIASQQQDSDTAPKQKRSRAHRKKMEDLAQLGIHGPFKKSLRRERRPFT
EQDDREILEGLDIYGPAWTKIQRDPRYHLSSRQPTDLRDRVRNKYPAVYGRIDKGAMQAADDARGNNTLEPSISI
SIDDSFQRSRTAHAIHLAGQYSFRERTHAPSLHTLDTIAGLTHPQTFEFAEVGAPHLMGGGEMDISRLLLDDSRL
TPLHPRHSFDGFSGPSSPSANGSEQRRERTEGHKVKC*
Coding >OphauB2|5748
ATGGCCACCATTGAGCCGCGTCTGATCCATCTGCTCAACGAGCCCACCACCCCTCAGCTCAACCACGCTGACTTG
CCGCCCCTTTACTCTCTGCCCTTGCCCGCGTCGACTGAACGCCCGCTTCCTCCGCTGGAGCCGGATACGAGCCAC
CGCTCCACCCTCGACGGCACATGCTTTACCTTTGCACCTCCGGCTCTCTCGAGCGACGAGTCGACGAGCCGAAAG
GACGACGCTCGGCTTGAATGGAGGAATCCCAGCGCCCCCATTGCCCACTCACTGCGACTACTCCTGGGCGATGGC
GATGCGCCAGAGCCCTCGCTTGCCTATGCAAAGATACTAAACGACTCATCTGATACCTGCGACGAATCCCACAGC
AAGAAGCGCGCCCGCACCGTTTGCGGCAAAGACGACTTTGTCCAGCTTCCGCAACCCGTCAAGAAGCAAAAGGCA
GCCCAGCAAGCACCCCCAATGCCCCCCATAATCAACGGCTTGCACGAACCGCCACCACAAGCCACTCTCTTTCCG
CCCATTTCATCCGAATCTTTTGGCACCAACCATGGTACCTCCAACATGAAGTTCTTATCAGATGTAAGCAGAAGT
GCCAACGACAAGGCAAACACTCCAACCTCGTCAGACGCCGACAGAAACGCAAACAAGGCGAGAAAACGTGCCGTT
AAACCGCGCCGCAAGTGGTCTGAACAAGAGACAAAACATCTGCTGCTTGGTGTTAACCGCCATGGCGTTGGAAAG
TGGACCACGATTCTCGATGATGCAGACTTTACCTTCAACGCCCGCACGGCTGGAGATCTCAAGGACAGATTCAGG
ACATGTTGTCCCGACGAGCTGCGCGGACCGAGCAAGAAAATGCCCCGACCCGCCTCACCTCCCCATCAACCACGT
CAATCCAAACCAAGAGCCAAAAAGGGCATTCATTCTGAGAACATCCTTATTGAAGAAAATAATCCCTCGCCACCA
GACTCGATTGCAAGCCAACAGCAAGACTCGGATACGGCCCCGAAACAGAAGAGGAGTCGTGCACATCGCAAGAAG
ATGGAGGATTTGGCCCAGCTGGGCATACATGGCCCCTTCAAGAAATCCCTCAGGCGCGAAAGGAGACCATTTACC
GAGCAAGATGACCGCGAAATACTAGAGGGCCTCGACATATATGGCCCTGCATGGACCAAGATTCAACGGGACCCA
CGCTACCACCTTTCCAGCCGACAGCCTACCGATCTTAGAGACAGAGTCCGCAACAAGTATCCTGCCGTCTATGGC
CGCATCGACAAAGGCGCCATGCAAGCCGCAGACGATGCTCGCGGCAACAATACTCTGGAACCATCCATCAGCATC
TCTATAGATGACTCGTTTCAGCGCTCCAGAACAGCGCATGCTATCCATCTGGCCGGCCAATATAGCTTTCGAGAA
AGAACACATGCACCTTCGTTGCACACGCTAGACACGATAGCTGGCTTGACTCACCCGCAAACTTTTGAGTTTGCC
GAAGTTGGTGCCCCTCATCTAATGGGCGGTGGAGAAATGGACATTTCTAGGCTTCTTTTAGATGACAGTCGACTT
ACACCCCTACATCCTCGGCACAGTTTTGATGGCTTTTCTGGACCCTCATCGCCCTCGGCAAACGGTTCAGAGCAG
CGGCGAGAGCGCACAGAAGGCCACAAGGTAAAATGTTAA
Transcript >OphauB2|5748
ATGGCCACCATTGAGCCGCGTCTGATCCATCTGCTCAACGAGCCCACCACCCCTCAGCTCAACCACGCTGACTTG
CCGCCCCTTTACTCTCTGCCCTTGCCCGCGTCGACTGAACGCCCGCTTCCTCCGCTGGAGCCGGATACGAGCCAC
CGCTCCACCCTCGACGGCACATGCTTTACCTTTGCACCTCCGGCTCTCTCGAGCGACGAGTCGACGAGCCGAAAG
GACGACGCTCGGCTTGAATGGAGGAATCCCAGCGCCCCCATTGCCCACTCACTGCGACTACTCCTGGGCGATGGC
GATGCGCCAGAGCCCTCGCTTGCCTATGCAAAGATACTAAACGACTCATCTGATACCTGCGACGAATCCCACAGC
AAGAAGCGCGCCCGCACCGTTTGCGGCAAAGACGACTTTGTCCAGCTTCCGCAACCCGTCAAGAAGCAAAAGGCA
GCCCAGCAAGCACCCCCAATGCCCCCCATAATCAACGGCTTGCACGAACCGCCACCACAAGCCACTCTCTTTCCG
CCCATTTCATCCGAATCTTTTGGCACCAACCATGGTACCTCCAACATGAAGTTCTTATCAGATGTAAGCAGAAGT
GCCAACGACAAGGCAAACACTCCAACCTCGTCAGACGCCGACAGAAACGCAAACAAGGCGAGAAAACGTGCCGTT
AAACCGCGCCGCAAGTGGTCTGAACAAGAGACAAAACATCTGCTGCTTGGTGTTAACCGCCATGGCGTTGGAAAG
TGGACCACGATTCTCGATGATGCAGACTTTACCTTCAACGCCCGCACGGCTGGAGATCTCAAGGACAGATTCAGG
ACATGTTGTCCCGACGAGCTGCGCGGACCGAGCAAGAAAATGCCCCGACCCGCCTCACCTCCCCATCAACCACGT
CAATCCAAACCAAGAGCCAAAAAGGGCATTCATTCTGAGAACATCCTTATTGAAGAAAATAATCCCTCGCCACCA
GACTCGATTGCAAGCCAACAGCAAGACTCGGATACGGCCCCGAAACAGAAGAGGAGTCGTGCACATCGCAAGAAG
ATGGAGGATTTGGCCCAGCTGGGCATACATGGCCCCTTCAAGAAATCCCTCAGGCGCGAAAGGAGACCATTTACC
GAGCAAGATGACCGCGAAATACTAGAGGGCCTCGACATATATGGCCCTGCATGGACCAAGATTCAACGGGACCCA
CGCTACCACCTTTCCAGCCGACAGCCTACCGATCTTAGAGACAGAGTCCGCAACAAGTATCCTGCCGTCTATGGC
CGCATCGACAAAGGCGCCATGCAAGCCGCAGACGATGCTCGCGGCAACAATACTCTGGAACCATCCATCAGCATC
TCTATAGATGACTCGTTTCAGCGCTCCAGAACAGCGCATGCTATCCATCTGGCCGGCCAATATAGCTTTCGAGAA
AGAACACATGCACCTTCGTTGCACACGCTAGACACGATAGCTGGCTTGACTCACCCGCAAACTTTTGAGTTTGCC
GAAGTTGGTGCCCCTCATCTAATGGGCGGTGGAGAAATGGACATTTCTAGGCTTCTTTTAGATGACAGTCGACTT
ACACCCCTACATCCTCGGCACAGTTTTGATGGCTTTTCTGGACCCTCATCGCCCTCGGCAAACGGTTCAGAGCAG
CGGCGAGAGCGCACAGAAGGCCACAAGGTAAAATGTTAA
Gene >OphauB2|5748
ATGGCCACCATTGAGCCGCGTCTGATCCATCTGCTCAACGAGCCCACCACCCCTCAGCTCAACCACGCTGACTTG
CCGCCCCTTTACTCTCTGCCCTTGCCCGCGTCGACTGAACGCCCGCTTCCTCCGCTGGAGCCGGATACGAGCCAC
CGCTCCACCCTCGACGGCACATGCTTTACCTTTGCACCTCCGGCTCTCTCGAGCGACGAGTCGACGAGCCGAAAG
GACGACGCTCGGCTTGAATGGAGGAATCCCAGCGCCCCCATTGCCCACTCACTGCGACTACTCCTGGGCGATGGC
GATGCGCCAGAGCCCTCGCTTGCCTATGCAAAGATACTAAACGACTCATCTGATACCTGCGACGAATCCCACAGC
AAGAAGCGCGCCCGCACCGTTTGCGGCAAAGACGACTTTGTCCAGCTTCCGCAACCCGTCAAGAAGCAAAAGGCA
GCCCAGCAAGCACCCCCAATGCCCCCCATAATCAACGGCTTGCACGAACCGCCACCACAAGCCACTCTCTTTCCG
CCCATTTCATCCGAATCTTTTGGCACCAACCATGGTACCTCCAACATGAAGTTCTTATCAGATGTAAGCAGAAGT
GCCAACGACAAGGCAAACACTCCAACCTCGTCAGACGCCGACAGAAACGCAAACAAGGCGAGAAAACGTGCCGTT
AAACCGCGCCGCAAGTGGTCTGAACAAGAGACAAAACATCTGCTGCTTGGTGTTAACCGCCATGGCGTTGGAAAG
TGGACCACGATTCTCGATGATGCAGACTTTACCTTCAACGCCCGCACGGCTGGAGATCTCAAGGACAGATTCAGG
ACATGTTGTCCCGACGAGCTGCGCGGACCGAGCAAGAAAATGCCCCGACCCGCCTCACCTCCCCATCAACCACGT
CAATCCAAACCAAGAGCCAAAAAGGGCATTCATTCTGAGAACATCCTTATTGAAGAAAATAATCCCTCGCCACCA
GACTCGATTGCAAGCCAACAGCAAGACTCGGATACGGCCCCGAAACAGAAGAGGAGTCGTGCACATCGCAAGAAG
ATGGAGGATTTGGCCCAGCTGGGCATACATGGCCCCTTCAAGAAATCCCTCAGGCGCGAAAGGAGACCATTTACC
GAGCAAGATGACCGCGAAATACTAGAGGGCCTCGACATATATGGCCCTGCATGGACCAAGATTCAACGGGACCCA
CGCTACCACCTTTCCAGCCGACAGCCTACCGATCTTAGAGACAGAGTCCGCAACAAGTATCCTGCCGTCTATGGC
CGCATCGACAAAGGCGCCATGCAAGCCGCAGACGATGCTCGCGGCAACAATACTCTGGAACCATCCATCAGCATC
TCTATAGATGACTCGTTTCAGCGCTCCAGAACAGCGCATGCTATCCATCTGGCCGGCCAATATAGCTTTCGAGAA
AGAACACATGCACCTTCGTTGCACACGCTAGACACGATAGCTGGCTTGACTCACCCGCAAACTTTTGAGTTTGCC
GAAGTTGGTGCCCCTCATCTAATGGGCGGTGGAGAAATGGACATTTCTAGGCTTCTTTTAGATGACAGTCGACTT
ACACCCCTACATCCTCGGCACAGTTTTGATGGCTTTTCTGGACCCTCATCGCCCTCGGCAAACGGTTCAGAGCAG
CGGCGAGAGCGCACAGAAGGCCACAAGGTAAAATGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail