Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5747
Gene name
LocationContig_47:115173..116222
Strand-
Gene length (bp)1049
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00900 Ribosomal_S4e Ribosomal family S4e 1.8E-35 95 169
PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus 1.6E-23 212 256
PF08071 RS4NT RS4NT (NUC023) domain 3.8E-18 3 39
PF01479 S4 S4 domain 1.7E-06 42 90
PF00467 KOW KOW motif 1.5E-05 178 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59950|RS4_YARLI 40S ribosomal protein S4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS4 PE=2 SV=1 1 256 1.0E-148
sp|P0CX36|RS4B_YEAST 40S ribosomal protein S4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4B PE=1 SV=1 1 256 1.0E-146
sp|P0CX35|RS4A_YEAST 40S ribosomal protein S4-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4A PE=1 SV=1 1 256 1.0E-146
sp|P87158|RS4A_SCHPO 40S ribosomal protein S4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps401 PE=2 SV=2 1 257 9.0E-146
sp|Q9USW5|RS4B_SCHPO 40S ribosomal protein S4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps402 PE=1 SV=1 1 257 3.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59950|RS4_YARLI 40S ribosomal protein S4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS4 PE=2 SV=1 1 256 1.0E-148
sp|P0CX36|RS4B_YEAST 40S ribosomal protein S4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4B PE=1 SV=1 1 256 1.0E-146
sp|P0CX35|RS4A_YEAST 40S ribosomal protein S4-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4A PE=1 SV=1 1 256 1.0E-146
sp|P87158|RS4A_SCHPO 40S ribosomal protein S4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps401 PE=2 SV=2 1 257 9.0E-146
sp|Q9USW5|RS4B_SCHPO 40S ribosomal protein S4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps402 PE=1 SV=1 1 257 3.0E-145
sp|Q9P4W9|RS4C_SCHPO 40S ribosomal protein S4-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps403 PE=1 SV=1 1 257 4.0E-145
sp|Q90YS0|RS4_ICTPU 40S ribosomal protein S4 OS=Ictalurus punctatus GN=rps4 PE=2 SV=3 1 260 1.0E-142
sp|P47961|RS4_CRIGR 40S ribosomal protein S4 OS=Cricetulus griseus GN=RPS4 PE=2 SV=2 1 260 2.0E-142
sp|P47836|RS4_CHICK 40S ribosomal protein S4 OS=Gallus gallus GN=RPS4 PE=2 SV=2 1 260 3.0E-142
sp|P79103|RS4_BOVIN 40S ribosomal protein S4 OS=Bos taurus GN=RPS4 PE=2 SV=3 1 260 5.0E-142
sp|P62703|RS4X_RAT 40S ribosomal protein S4, X isoform OS=Rattus norvegicus GN=Rps4x PE=2 SV=2 1 260 5.0E-142
sp|P62702|RS4X_MOUSE 40S ribosomal protein S4, X isoform OS=Mus musculus GN=Rps4x PE=1 SV=2 1 260 5.0E-142
sp|P62704|RS4X_MESAU 40S ribosomal protein S4, X isoform OS=Mesocricetus auratus GN=RPS4X PE=2 SV=2 1 260 5.0E-142
sp|Q76MY1|RS4X_MACFU 40S ribosomal protein S4, X isoform OS=Macaca fuscata fuscata GN=RPS4X PE=2 SV=3 1 260 5.0E-142
sp|P62701|RS4X_HUMAN 40S ribosomal protein S4, X isoform OS=Homo sapiens GN=RPS4X PE=1 SV=2 1 260 5.0E-142
sp|P62705|RS4X_FELCA 40S ribosomal protein S4, X isoform OS=Felis catus GN=RPS4X PE=2 SV=2 1 260 5.0E-142
sp|Q76N24|RS4X_CHLAE 40S ribosomal protein S4, X isoform OS=Chlorocebus aethiops GN=RPS4X PE=2 SV=3 1 260 5.0E-142
sp|Q6PBC4|RS4_XENTR 40S ribosomal protein S4 OS=Xenopus tropicalis GN=rps4 PE=2 SV=3 1 260 6.0E-142
sp|Q642H9|RS4X_DANRE 40S ribosomal protein S4, X isoform OS=Danio rerio GN=rps4x PE=2 SV=3 1 260 2.0E-141
sp|P49401|RS4_XENLA 40S ribosomal protein S4 OS=Xenopus laevis GN=rps4 PE=2 SV=4 1 260 3.0E-141
sp|O62739|RS4Y1_MONDO 40S ribosomal protein S4, Y isoform 1 OS=Monodelphis domestica GN=RPS4Y1 PE=2 SV=3 1 260 1.0E-140
sp|P79183|RS4Y1_MACFU 40S ribosomal protein S4, Y isoform 1 OS=Macaca fuscata fuscata GN=RPS4Y1 PE=2 SV=3 1 260 2.0E-139
sp|O62738|RS4X_MONDO 40S ribosomal protein S4, X isoform OS=Monodelphis domestica GN=RPS4X PE=2 SV=3 1 261 1.0E-138
sp|Q6GVM7|RS4Y2_PANTR 40S ribosomal protein S4, Y isoform 2 OS=Pan troglodytes GN=RPS4Y2 PE=2 SV=3 1 260 2.0E-138
sp|P22090|RS4Y1_HUMAN 40S ribosomal protein S4, Y isoform 1 OS=Homo sapiens GN=RPS4Y1 PE=1 SV=2 1 260 4.0E-138
sp|Q861U8|RS4Y1_GORGO 40S ribosomal protein S4, Y isoform 1 OS=Gorilla gorilla gorilla GN=RPS4Y1 PE=3 SV=2 1 260 6.0E-138
sp|Q861U7|RS4Y1_PONPY 40S ribosomal protein S4, Y isoform 1 OS=Pongo pygmaeus GN=RPS4Y1 PE=3 SV=2 1 260 2.0E-137
sp|Q861U9|RS4Y1_PANTR 40S ribosomal protein S4, Y isoform 1 OS=Pan troglodytes GN=RPS4Y1 PE=2 SV=2 1 260 3.0E-137
sp|Q861V0|RS4Y1_PANPA 40S ribosomal protein S4, Y isoform 1 OS=Pan paniscus GN=RPS4Y1 PE=3 SV=2 1 260 3.0E-137
sp|P47837|RS4_CANAX 40S ribosomal protein S4 OS=Candida albicans GN=RPS4 PE=3 SV=1 1 256 2.0E-136
sp|Q8TD47|RS4Y2_HUMAN 40S ribosomal protein S4, Y isoform 2 OS=Homo sapiens GN=RPS4Y2 PE=2 SV=3 1 260 2.0E-134
sp|Q95V34|RS4_SPOFR 40S ribosomal protein S4 OS=Spodoptera frugiperda GN=RpS4 PE=2 SV=1 1 256 6.0E-133
sp|P41042|RS4_DROME 40S ribosomal protein S4 OS=Drosophila melanogaster GN=RpS4 PE=1 SV=2 1 261 6.0E-133
sp|Q4PMB3|RS4_IXOSC 40S ribosomal protein S4 OS=Ixodes scapularis GN=RpS4 PE=2 SV=1 1 261 1.0E-132
sp|Q4GXU6|RS4_CARGR 40S ribosomal protein S4 OS=Carabus granulatus GN=RpS4 PE=2 SV=1 1 261 2.0E-132
sp|Q5UAP0|RS4_BOMMO 40S ribosomal protein S4 OS=Bombyx mori GN=RpS4 PE=2 SV=1 1 256 2.0E-131
sp|Q56FH2|RS4_LYSTE 40S ribosomal protein S4 OS=Lysiphlebus testaceipes GN=RpS4 PE=2 SV=1 1 256 9.0E-130
sp|O22424|RS4_MAIZE 40S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 SV=1 1 254 2.0E-126
sp|P49398|RS4_ORYSJ 40S ribosomal protein S4 OS=Oryza sativa subsp. japonica GN=RPS4 PE=2 SV=3 1 254 2.0E-126
sp|Q8VYK6|RS43_ARATH 40S ribosomal protein S4-3 OS=Arabidopsis thaliana GN=RPS4D PE=2 SV=2 1 260 5.0E-126
sp|P49204|RS42_ARATH 40S ribosomal protein S4-2 OS=Arabidopsis thaliana GN=RPS4B PE=2 SV=4 1 260 5.0E-126
sp|Q93VH9|RS41_ARATH 40S ribosomal protein S4-1 OS=Arabidopsis thaliana GN=RPS4A PE=2 SV=1 1 260 1.0E-125
sp|P46300|RS4_SOLTU 40S ribosomal protein S4 OS=Solanum tuberosum GN=RPS4 PE=2 SV=1 1 260 1.0E-125
sp|P46299|RS4_GOSHI 40S ribosomal protein S4 OS=Gossypium hirsutum GN=RPS4 PE=2 SV=1 1 260 8.0E-124
sp|P51405|RS4_DICDI 40S ribosomal protein S4 OS=Dictyostelium discoideum GN=rps4 PE=1 SV=3 1 252 2.0E-116
sp|O81363|RS4_PRUAR 40S ribosomal protein S4 OS=Prunus armeniaca GN=RPS4 PE=2 SV=1 1 254 4.0E-115
sp|Q9N3X2|RS4_CAEEL 40S ribosomal protein S4 OS=Caenorhabditis elegans GN=rps-4 PE=1 SV=1 3 261 3.0E-114
sp|P55832|RS4_HORSE 40S ribosomal protein S4 (Fragment) OS=Equus caballus GN=RPS4 PE=2 SV=1 20 213 3.0E-107
sp|P0C233|RS4_TETTH 40S ribosomal protein S4 OS=Tetrahymena thermophila PE=1 SV=1 2 254 9.0E-90
sp|Q8SRB9|RS4_ENCCU 40S ribosomal protein S4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS4 PE=1 SV=1 1 250 3.0E-57
sp|A2BMD1|RS4E_HYPBU 30S ribosomal protein S4e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps4e PE=3 SV=1 1 240 4.0E-45
sp|O26123|RS4E_METTH 30S ribosomal protein S4e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps4e PE=3 SV=1 6 241 4.0E-44
sp|A3DNB9|RS4E_STAMF 30S ribosomal protein S4e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps4e PE=3 SV=1 1 240 4.0E-43
sp|Q9YF85|RS4E_AERPE 30S ribosomal protein S4e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps4e PE=3 SV=2 1 240 1.0E-42
sp|Q2NFW9|RS4E_METST 30S ribosomal protein S4e OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps4e PE=3 SV=1 4 237 4.0E-41
sp|Q5JJG0|RS4E_THEKO 30S ribosomal protein S4e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps4e PE=3 SV=1 1 238 7.0E-41
sp|O59430|RS4E_PYRHO 30S ribosomal protein S4e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps4e PE=3 SV=1 1 238 8.0E-41
sp|A8ACD4|RS4E_IGNH4 30S ribosomal protein S4e OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps4e PE=3 SV=1 1 240 1.0E-40
sp|Q9V1U8|RS4E_PYRAB 30S ribosomal protein S4e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps4e PE=3 SV=1 1 238 1.0E-39
sp|Q8U011|RS4E_PYRFU 30S ribosomal protein S4e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps4e PE=1 SV=1 1 238 2.0E-38
sp|P54039|RS4E_METJA 30S ribosomal protein S4e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps4e PE=3 SV=1 3 237 2.0E-37
sp|A4FWA9|RS4E_METM5 30S ribosomal protein S4e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps4e PE=3 SV=1 3 237 3.0E-37
sp|A6UQ56|RS4E_METVS 30S ribosomal protein S4e OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps4e PE=3 SV=1 3 237 6.0E-37
sp|P14023|RS4E_METVA 30S ribosomal protein S4e OS=Methanococcus vannielii GN=rps4e PE=3 SV=1 3 237 6.0E-37
sp|A6VGZ7|RS4E_METM7 30S ribosomal protein S4e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps4e PE=3 SV=1 3 237 1.0E-36
sp|A9A9Q2|RS4E_METM6 30S ribosomal protein S4e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps4e PE=3 SV=1 3 237 2.0E-36
sp|P62428|RS4E_METMP 30S ribosomal protein S4e OS=Methanococcus maripaludis (strain S2 / LL) GN=rps4e PE=3 SV=1 3 237 7.0E-36
sp|A5UL76|RS4E_METS3 30S ribosomal protein S4e OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps4e PE=3 SV=1 1 237 8.0E-36
sp|B1L778|RS4E_KORCO 30S ribosomal protein S4e OS=Korarchaeum cryptofilum (strain OPF8) GN=rps4e PE=3 SV=1 4 237 3.0E-35
sp|B8D5V8|RS4E_DESK1 30S ribosomal protein S4e OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rps4e PE=3 SV=1 2 240 1.0E-34
sp|Q8TW18|RS4E_METKA 30S ribosomal protein S4e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps4e PE=3 SV=1 4 237 8.0E-33
sp|O28366|RS4E_ARCFU 30S ribosomal protein S4e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps4e PE=3 SV=1 5 237 4.0E-32
sp|A1RS06|RS4E_PYRIL 30S ribosomal protein S4e OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps4e PE=3 SV=1 8 193 1.0E-30
sp|Q46GA7|RS4E_METBF 30S ribosomal protein S4e OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps4e PE=3 SV=1 8 237 2.0E-30
sp|Q8TRT5|RS4E_METAC 30S ribosomal protein S4e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps4e PE=3 SV=1 8 237 2.0E-30
sp|A6UWV0|RS4E_META3 30S ribosomal protein S4e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps4e PE=3 SV=1 3 237 3.0E-30
sp|Q97BW4|RS4E_THEVO 30S ribosomal protein S4e OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps4e PE=3 SV=1 10 241 1.0E-29
sp|B1Y9S4|RS4E_PYRNV 30S ribosomal protein S4e OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps4e PE=3 SV=1 8 190 2.0E-29
sp|C3NEF5|RS4E_SULIY 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rps4e PE=3 SV=1 8 233 2.0E-28
sp|C3NH97|RS4E_SULIN 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps4e PE=3 SV=1 8 233 2.0E-28
sp|C3MVJ0|RS4E_SULIM 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rps4e PE=3 SV=1 8 233 2.0E-28
sp|C3MQ71|RS4E_SULIL 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rps4e PE=3 SV=1 8 233 2.0E-28
sp|C4KHG8|RS4E_SULIK 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rps4e PE=3 SV=1 8 233 2.0E-28
sp|C3N5T9|RS4E_SULIA 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain M.16.27) GN=rps4e PE=3 SV=1 8 233 2.0E-28
sp|A4WLL4|RS4E_PYRAR 30S ribosomal protein S4e OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps4e PE=3 SV=1 8 193 2.0E-28
sp|A3MWZ7|RS4E_PYRCJ 30S ribosomal protein S4e OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps4e PE=3 SV=1 8 193 2.0E-28
sp|Q8PV38|RS4E_METMA 30S ribosomal protein S4e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps4e PE=3 SV=1 8 237 3.0E-28
sp|Q8ZTD3|RS4E_PYRAE 30S ribosomal protein S4e OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps4e PE=3 SV=1 8 195 1.0E-27
sp|Q0W1X6|RS4E_METAR 30S ribosomal protein S4e OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4e PE=3 SV=1 8 244 1.0E-27
sp|Q56230|RS4E_THEAC 30S ribosomal protein S4e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps4e PE=1 SV=2 10 232 4.0E-27
sp|A8MB20|RS4E_CALMQ 30S ribosomal protein S4e OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps4e PE=3 SV=1 8 231 4.0E-27
sp|Q40941|RS4_BIGNA 40S ribosomal protein S4 OS=Bigelowiella natans GN=RPS4 PE=3 SV=1 1 235 8.0E-27
sp|Q9UX94|RS4E_SULSO 30S ribosomal protein S4e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps4e PE=3 SV=1 8 233 3.0E-26
sp|P62429|RS4E_NANEQ 30S ribosomal protein S4e OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps4e PE=3 SV=1 1 223 8.0E-26
sp|B9LSR5|RS4E_HALLT 30S ribosomal protein S4e OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rps4e PE=3 SV=1 5 231 2.0E-24
sp|Q975J2|RS4E_SULTO 30S ribosomal protein S4e OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps4e PE=3 SV=2 8 232 2.0E-24
sp|O05634|RS4E_SULAC 30S ribosomal protein S4e OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps4e PE=3 SV=1 8 245 3.0E-24
sp|Q3IMX6|RS4E_NATPD 30S ribosomal protein S4e OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps4e PE=3 SV=1 5 231 2.0E-23
sp|Q6L1B5|RS4E_PICTO 30S ribosomal protein S4e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps4e PE=3 SV=1 10 240 7.0E-23
sp|P22510|RS4E_HALMA 30S ribosomal protein S4E OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps4e PE=1 SV=3 5 231 8.0E-23
sp|Q2FT37|RS4E_METHJ 30S ribosomal protein S4e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps4e PE=3 SV=1 8 235 2.0E-22
sp|Q9HPC2|RS4E_HALSA 30S ribosomal protein S4e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps4e PE=3 SV=1 5 231 6.0E-22
sp|B0R668|RS4E_HALS3 30S ribosomal protein S4e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps4e PE=3 SV=1 5 231 6.0E-22
sp|A4YCX8|RS4E_METS5 30S ribosomal protein S4e OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps4e PE=3 SV=1 8 232 3.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5747
MARGIKKHQKRLSAPSHWLLDKLSGVYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRECKAILMQRLVKVDGK
VRTDMTYPAGFMDVISIEKTGENFRLIYDTKGRFTVHRIQAEEAEYKLGKVKRVQLGRGGIPFLVTHDARTIRYP
DPLIKVNDTVKIDLKTGKVTDFIKFDTGAIAMVTGGRNMGRVGVITHRERHDGGFNIVHIKDAIDNTFATRENNV
FVIGQDKAWISLPKGKGVKLTIAEERDRRRAIAQSH*
Coding >OphauB2|5747
ATGGCTCGTGGAATTAAAAAGCATCAGAAGCGCCTCAGCGCGCCTTCGCACTGGCTGCTTGACAAACTCTCTGGT
GTTTATGCACCAAAGCCATCAGCCGGTCCTCACAAGCTACGCGACTGCATGCCTCTTATTGTCTTCATCCGCAAC
CGCCTCAAGTATGCCCTCAACTATCGCGAGTGCAAGGCCATCCTCATGCAGCGCCTTGTCAAGGTCGATGGCAAG
GTTCGCACCGATATGACGTATCCTGCCGGTTTTATGGATGTCATTAGCATTGAAAAGACGGGCGAGAACTTTCGG
CTCATCTACGACACCAAGGGTCGATTTACTGTGCACCGCATTCAGGCTGAGGAGGCCGAATACAAGTTGGGCAAG
GTCAAGCGTGTTCAGCTTGGTCGTGGTGGAATCCCATTCTTGGTGACGCACGATGCGAGAACCATTCGCTACCCT
GACCCACTCATCAAGGTCAACGACACTGTCAAGATTGACCTCAAGACGGGAAAGGTGACTGACTTTATCAAATTC
GATACGGGCGCCATAGCCATGGTGACTGGCGGTCGCAACATGGGCCGTGTTGGTGTTATTACGCATCGTGAGCGC
CATGATGGAGGCTTCAACATTGTTCACATCAAGGACGCTATTGACAACACGTTTGCTACGCGTGAAAACAACGTT
TTTGTCATTGGTCAGGACAAGGCGTGGATCTCTCTGCCAAAGGGCAAGGGTGTTAAGCTCACGATCGCCGAGGAA
CGTGATCGTCGGCGGGCTATTGCTCAGTCTCACTAG
Transcript >OphauB2|5747
ATGGCTCGTGGAATTAAAAAGCATCAGAAGCGCCTCAGCGCGCCTTCGCACTGGCTGCTTGACAAACTCTCTGGT
GTTTATGCACCAAAGCCATCAGCCGGTCCTCACAAGCTACGCGACTGCATGCCTCTTATTGTCTTCATCCGCAAC
CGCCTCAAGTATGCCCTCAACTATCGCGAGTGCAAGGCCATCCTCATGCAGCGCCTTGTCAAGGTCGATGGCAAG
GTTCGCACCGATATGACGTATCCTGCCGGTTTTATGGATGTCATTAGCATTGAAAAGACGGGCGAGAACTTTCGG
CTCATCTACGACACCAAGGGTCGATTTACTGTGCACCGCATTCAGGCTGAGGAGGCCGAATACAAGTTGGGCAAG
GTCAAGCGTGTTCAGCTTGGTCGTGGTGGAATCCCATTCTTGGTGACGCACGATGCGAGAACCATTCGCTACCCT
GACCCACTCATCAAGGTCAACGACACTGTCAAGATTGACCTCAAGACGGGAAAGGTGACTGACTTTATCAAATTC
GATACGGGCGCCATAGCCATGGTGACTGGCGGTCGCAACATGGGCCGTGTTGGTGTTATTACGCATCGTGAGCGC
CATGATGGAGGCTTCAACATTGTTCACATCAAGGACGCTATTGACAACACGTTTGCTACGCGTGAAAACAACGTT
TTTGTCATTGGTCAGGACAAGGCGTGGATCTCTCTGCCAAAGGGCAAGGGTGTTAAGCTCACGATCGCCGAGGAA
CGTGATCGTCGGCGGGCTATTGCTCAGTCTCACTAG
Gene >OphauB2|5747
ATGGCTCGTGGAATGTAAGTAGAAGCCAAAGTCTAGGACCCAATTGATTACGATGCAGCAAGAAATGAGCTGCTG
GATTACTACTGTAATGGGCAATCTTCATAGCAGAGCATGGACGCTGATTGCACGGCAGTAAAAAGCATCAGAAGC
GCCTCAGCGCGCCTTCGCACTGGCTGCTTGACAAACTCTCTGGTGTTTATGCACCAAAGCCATCAGCCGGTCCTC
ACAAGCTACGCGACTGCATGCCTCTTATTGTCTTCATCCGCAACCGCCTCAAGTATGCCCTCAACTATCGCGAGT
GCAAGGCCATCCTCATGCAGCGCCTTGTCAAGGTCGATGGCAAGGTTCGCACCGATATGACGTATCCTGCCGGTT
TTATGGATGTCATTAGCATTGAAAAGACGGGCGAGAACTTTCGGCTCATCTACGACACCAAGGGTCGATTTACTG
TGCACCGCATTCAGGCTGAGGAGGCCGAATACAAGTTGGGCAAGGTCAAGCGTGTTCAGCTTGGTCGTGGTGGAA
TCCCATTCTTGGTGACGCACGATGCGAGAACGTGAGTTCTGTCAGACATCATTCAGCCGTTGAATCAAGCTTTGG
TAGATTCGGAGTCACCAGACGACGCGTCGATGGAGCTGGATTTGACGGTTGTGAGTCGTCTCTTTTGTCTGCTTG
AATGCTGATGTCTTGTTACCTCTAGCATTCGCTACCCTGACCCACTCATCAAGGTCAACGACACTGTCAAGATTG
ACCTCAAGACGGGAAAGGTGACTGACTTTATCAAATTCGATACGGGCGCCATAGCCATGGTGACTGGCGGTCGCA
ACATGGGCCGTGTTGGTGTTATTACGCATCGTGAGCGCCATGATGGAGGCTTCAACATTGTTCACATCAAGGACG
CTATTGACAACACGTTTGCTACGCGTGAAAACAACGTTTTTGTCATTGGTCAGGACAAGGCGTGGATCTCTCTGC
CAAAGGGCAAGGGTGTTAAGCTCACGATCGCCGAGGAACGTGATCGTCGGCGGGCTATTGCTCAGTCTCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail