Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5732
Gene name
LocationContig_47:62318..63813
Strand-
Gene length (bp)1495
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00206 Lyase_1 Lyase 7.6E-109 14 347
PF10415 FumaraseC_C Fumarase C C-terminus 1.6E-21 413 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55250|FUMH_RHIOR Fumarate hydratase, mitochondrial OS=Rhizopus oryzae GN=FUMR PE=3 SV=1 5 468 0.0E+00
sp|O17214|FUMH_CAEEL Probable fumarate hydratase, mitochondrial OS=Caenorhabditis elegans GN=fum-1 PE=3 SV=1 5 468 0.0E+00
sp|P08417|FUMH_YEAST Fumarate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUM1 PE=1 SV=2 7 468 0.0E+00
sp|Q9FI53|FUM2_ARATH Fumarate hydratase 2, chloroplastic OS=Arabidopsis thaliana GN=FUM2 PE=2 SV=1 7 467 0.0E+00
sp|Q60HF9|FUMH_MACFA Fumarate hydratase, mitochondrial OS=Macaca fascicularis GN=FH PE=2 SV=1 7 468 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55250|FUMH_RHIOR Fumarate hydratase, mitochondrial OS=Rhizopus oryzae GN=FUMR PE=3 SV=1 5 468 0.0E+00
sp|O17214|FUMH_CAEEL Probable fumarate hydratase, mitochondrial OS=Caenorhabditis elegans GN=fum-1 PE=3 SV=1 5 468 0.0E+00
sp|P08417|FUMH_YEAST Fumarate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUM1 PE=1 SV=2 7 468 0.0E+00
sp|Q9FI53|FUM2_ARATH Fumarate hydratase 2, chloroplastic OS=Arabidopsis thaliana GN=FUM2 PE=2 SV=1 7 467 0.0E+00
sp|Q60HF9|FUMH_MACFA Fumarate hydratase, mitochondrial OS=Macaca fascicularis GN=FH PE=2 SV=1 7 468 0.0E+00
sp|P14408|FUMH_RAT Fumarate hydratase, mitochondrial OS=Rattus norvegicus GN=Fh PE=1 SV=1 7 468 0.0E+00
sp|P07954|FUMH_HUMAN Fumarate hydratase, mitochondrial OS=Homo sapiens GN=FH PE=1 SV=3 7 468 0.0E+00
sp|P10173|FUMH_PIG Fumarate hydratase, mitochondrial OS=Sus scrofa GN=FH PE=1 SV=1 7 468 0.0E+00
sp|P97807|FUMH_MOUSE Fumarate hydratase, mitochondrial OS=Mus musculus GN=Fh PE=1 SV=3 7 468 0.0E+00
sp|Q7SX99|FUMH_DANRE Fumarate hydratase, mitochondrial OS=Danio rerio GN=fh PE=2 SV=1 7 468 0.0E+00
sp|P93033|FUM1_ARATH Fumarate hydratase 1, mitochondrial OS=Arabidopsis thaliana GN=FUM1 PE=2 SV=2 7 467 0.0E+00
sp|O94552|FUMH_SCHPO Fumarate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fum1 PE=3 SV=3 4 468 0.0E+00
sp|Q92PB6|FUMC_RHIME Fumarate hydratase class II OS=Rhizobium meliloti (strain 1021) GN=fumC PE=1 SV=2 6 467 0.0E+00
sp|Q54VA2|FUMH_DICDI Fumarate hydratase, mitochondrial OS=Dictyostelium discoideum GN=fumH PE=3 SV=1 7 466 0.0E+00
sp|Q983U5|FUMC_RHILO Fumarate hydratase class II OS=Rhizobium loti (strain MAFF303099) GN=fumC PE=3 SV=1 1 467 0.0E+00
sp|Q8FX90|FUMC_BRUSU Fumarate hydratase class II OS=Brucella suis biovar 1 (strain 1330) GN=fumC PE=3 SV=1 6 468 0.0E+00
sp|Q8YB50|FUMC_BRUME Fumarate hydratase class II OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fumC PE=3 SV=2 6 468 0.0E+00
sp|Q8UEY7|FUMC_AGRFC Fumarate hydratase class II OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fumC PE=3 SV=2 1 468 0.0E+00
sp|Q8F9L0|FUMC_LEPIN Fumarate hydratase class II OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=fumC PE=3 SV=1 5 467 0.0E+00
sp|Q72VY3|FUMC_LEPIC Fumarate hydratase class II OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=fumC PE=3 SV=1 5 467 0.0E+00
sp|Q4UMT4|FUMC_RICFE Fumarate hydratase class II OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fumC PE=3 SV=1 7 466 0.0E+00
sp|P28894|FUMC1_BRADU Fumarate hydratase class II 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fumC1 PE=3 SV=3 6 467 0.0E+00
sp|Q7N4H8|FUMC_PHOLL Fumarate hydratase class II OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fumC PE=3 SV=1 6 466 0.0E+00
sp|Q92GW0|FUMC_RICCN Fumarate hydratase class II OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fumC PE=3 SV=1 7 465 0.0E+00
sp|Q8ZPL7|FUMC_SALTY Fumarate hydratase class II OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fumC PE=3 SV=1 7 466 0.0E+00
sp|Q8KTE1|FUMC_METEA Fumarate hydratase class II OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=fumC PE=3 SV=1 5 467 0.0E+00
sp|Q8XQE8|FUMC_RALSO Fumarate hydratase class II OS=Ralstonia solanacearum (strain GMI1000) GN=fumC PE=3 SV=1 6 466 0.0E+00
sp|Q8Z6R6|FUMC_SALTI Fumarate hydratase class II OS=Salmonella typhi GN=fumC PE=3 SV=1 7 466 0.0E+00
sp|Q9ZCQ4|FUMC_RICPR Fumarate hydratase class II OS=Rickettsia prowazekii (strain Madrid E) GN=fumC PE=1 SV=1 7 465 0.0E+00
sp|Q1RHL6|FUMC_RICBR Fumarate hydratase class II OS=Rickettsia bellii (strain RML369-C) GN=fumC PE=3 SV=1 7 465 0.0E+00
sp|Q68W74|FUMC_RICTY Fumarate hydratase class II OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fumC PE=3 SV=1 7 465 0.0E+00
sp|Q8ZEB6|FUMC_YERPE Fumarate hydratase class II OS=Yersinia pestis GN=fumC PE=3 SV=1 6 466 0.0E+00
sp|Q9A6I5|FUMC_CAUCR Fumarate hydratase class II OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fumC PE=3 SV=1 1 467 0.0E+00
sp|Q7W4N9|FUMC_BORPA Fumarate hydratase class II OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=fumC PE=3 SV=1 5 461 0.0E+00
sp|Q7WG65|FUMC_BORBR Fumarate hydratase class II OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fumC PE=3 SV=1 5 461 0.0E+00
sp|Q7W0A2|FUMC_BORPE Fumarate hydratase class II OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=fumC PE=3 SV=1 5 461 0.0E+00
sp|P95331|FUMC_MYXXD Fumarate hydratase class II OS=Myxococcus xanthus (strain DK 1622) GN=fumC PE=3 SV=2 1 468 0.0E+00
sp|Q8X769|FUMC_ECO57 Fumarate hydratase class II OS=Escherichia coli O157:H7 GN=fumC PE=3 SV=1 7 466 0.0E+00
sp|P05042|FUMC_ECOLI Fumarate hydratase class II OS=Escherichia coli (strain K12) GN=fumC PE=1 SV=1 7 466 0.0E+00
sp|Q8FHA7|FUMC_ECOL6 Fumarate hydratase class II OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fumC PE=3 SV=1 7 466 0.0E+00
sp|Q83ML8|FUMC_SHIFL Fumarate hydratase class II OS=Shigella flexneri GN=fumC PE=3 SV=1 7 466 0.0E+00
sp|Q9ZJQ9|FUMC_HELPJ Fumarate hydratase class II OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fumC PE=3 SV=1 7 468 0.0E+00
sp|O69294|FUMC_CAMJE Fumarate hydratase class II OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=fumC PE=3 SV=1 7 468 0.0E+00
sp|O25883|FUMC_HELPY Fumarate hydratase class II OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fumC PE=3 SV=1 7 468 0.0E+00
sp|Q82SM5|FUMC_NITEU Fumarate hydratase class II OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=fumC PE=3 SV=1 5 464 0.0E+00
sp|Q55674|FUMC_SYNY3 Fumarate hydratase class II OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fumC PE=3 SV=1 7 467 0.0E+00
sp|P07343|FUMC_BACSU Fumarate hydratase class II OS=Bacillus subtilis (strain 168) GN=fumC PE=3 SV=2 7 468 0.0E+00
sp|Q9CMK1|FUMC_PASMU Fumarate hydratase class II OS=Pasteurella multocida (strain Pm70) GN=fumC PE=3 SV=1 7 466 0.0E+00
sp|Q8DIP7|FUMC_THEEB Fumarate hydratase class II OS=Thermosynechococcus elongatus (strain BP-1) GN=fumC PE=3 SV=1 6 468 0.0E+00
sp|Q81F85|FUMC_BACCR Fumarate hydratase class II OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fumC PE=3 SV=1 7 468 0.0E+00
sp|Q83CL8|FUMC_COXBU Fumarate hydratase class II OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fumC PE=3 SV=2 7 466 0.0E+00
sp|Q81SA0|FUMC_BACAN Fumarate hydratase class II OS=Bacillus anthracis GN=fumC PE=3 SV=1 7 468 0.0E+00
sp|P71384|FUMC_HAEIN Fumarate hydratase class II OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fumC PE=3 SV=1 7 466 2.0E-176
sp|Q822D5|FUMC_CHLCV Fumarate hydratase class II OS=Chlamydophila caviae (strain GPIC) GN=fumC PE=3 SV=1 7 466 2.0E-173
sp|Q6GFK5|FUMC_STAAR Fumarate hydratase class II OS=Staphylococcus aureus (strain MRSA252) GN=fumC PE=3 SV=1 7 467 1.0E-172
sp|Q5HES4|FUMC_STAAC Fumarate hydratase class II OS=Staphylococcus aureus (strain COL) GN=fumC PE=3 SV=1 7 467 1.0E-172
sp|Q7VKC9|FUMC_HAEDU Fumarate hydratase class II OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=fumC PE=3 SV=1 7 466 2.0E-172
sp|P64173|FUMC_STAAN Fumarate hydratase class II OS=Staphylococcus aureus (strain N315) GN=fumC PE=1 SV=1 7 467 4.0E-172
sp|P64172|FUMC_STAAM Fumarate hydratase class II OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fumC PE=3 SV=1 7 467 4.0E-172
sp|Q8NVV1|FUMC_STAAW Fumarate hydratase class II OS=Staphylococcus aureus (strain MW2) GN=fumC PE=3 SV=1 7 467 5.0E-172
sp|Q6G884|FUMC_STAAS Fumarate hydratase class II OS=Staphylococcus aureus (strain MSSA476) GN=fumC PE=3 SV=1 7 467 5.0E-172
sp|Q9Z6P6|FUMC_CHLPN Fumarate hydratase class II OS=Chlamydia pneumoniae GN=fumC PE=3 SV=1 7 466 2.0E-171
sp|Q7NZ02|FUMC_CHRVO Fumarate hydratase class II OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=fumC PE=3 SV=1 6 465 5.0E-171
sp|Q8CNR1|FUMC_STAES Fumarate hydratase class II OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fumC PE=3 SV=1 7 467 1.0E-170
sp|Q5HN85|FUMC_STAEQ Fumarate hydratase class II OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fumC PE=3 SV=1 7 467 1.0E-170
sp|Q8D2L3|FUMC_WIGBR Fumarate hydratase class II OS=Wigglesworthia glossinidia brevipalpis GN=fumC PE=3 SV=1 7 468 1.0E-170
sp|Q4L7F5|FUMC_STAHJ Fumarate hydratase class II OS=Staphylococcus haemolyticus (strain JCSC1435) GN=fumC PE=3 SV=1 7 467 1.0E-170
sp|Q9JTR0|FUMC_NEIMA Fumarate hydratase class II OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fumC PE=3 SV=1 5 468 1.0E-169
sp|Q8CUH5|FUMC_OCEIH Fumarate hydratase class II OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=fumC PE=3 SV=1 7 468 2.0E-169
sp|Q49YP8|FUMC_STAS1 Fumarate hydratase class II OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=fumC PE=3 SV=1 7 468 2.0E-168
sp|Q885V0|FUMC_PSESM Fumarate hydratase class II OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fumC PE=3 SV=1 6 465 3.0E-168
sp|Q8TS07|FUMC_METAC Fumarate hydratase class II OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fumC PE=3 SV=2 7 466 3.0E-166
sp|O84863|FUMC_CHLTR Fumarate hydratase class II OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fumC PE=3 SV=1 7 471 3.0E-165
sp|Q9RR70|FUMC_DEIRA Fumarate hydratase class II OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=fumC PE=3 SV=1 5 461 5.0E-165
sp|O66271|FUMC_THET2 Fumarate hydratase class II OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=fumC PE=3 SV=2 7 467 1.0E-164
sp|Q9I587|FUMC2_PSEAE Fumarate hydratase class II 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fumC2 PE=3 SV=1 6 465 7.0E-164
sp|Q9KCX4|FUMC_BACHD Fumarate hydratase class II OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fumC PE=3 SV=1 6 468 3.0E-163
sp|Q60022|FUMC_THEAQ Fumarate hydratase class II OS=Thermus aquaticus GN=fumC PE=3 SV=1 7 467 7.0E-163
sp|Q88M20|FUMC_PSEPK Fumarate hydratase class II OS=Pseudomonas putida (strain KT2440) GN=fumC PE=3 SV=1 6 467 4.0E-162
sp|Q9PL64|FUMC_CHLMU Fumarate hydratase class II OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fumC PE=3 SV=1 7 468 5.0E-162
sp|Q89XM2|FUMC2_BRADU Fumarate hydratase class II 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fumC2 PE=3 SV=2 7 472 3.0E-159
sp|Q7V5R2|FUMC_PROMM Fumarate hydratase class II OS=Prochlorococcus marinus (strain MIT 9313) GN=fumC PE=3 SV=1 1 464 2.0E-155
sp|Q929E8|FUMC_LISIN Fumarate hydratase class II OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fumC PE=3 SV=1 7 461 5.0E-154
sp|Q71XE0|FUMC_LISMF Fumarate hydratase class II OS=Listeria monocytogenes serotype 4b (strain F2365) GN=fumC PE=3 SV=1 7 461 1.0E-153
sp|Q8Y551|FUMC_LISMO Fumarate hydratase class II OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fumC PE=3 SV=1 7 461 3.0E-153
sp|Q7VR50|FUMC_BLOFL Fumarate hydratase class II OS=Blochmannia floridanus GN=fumC PE=3 SV=1 20 467 3.0E-152
sp|Q7U8I1|FUMC_SYNPX Fumarate hydratase class II OS=Synechococcus sp. (strain WH8102) GN=fumC PE=3 SV=2 7 468 3.0E-149
sp|Q9HQ29|FUMC_HALSA Fumarate hydratase class II OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fumC PE=3 SV=1 7 464 5.0E-146
sp|Q7VA47|FUMC_PROMA Fumarate hydratase class II OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=fumC PE=3 SV=1 3 466 6.0E-144
sp|Q8NRN8|FUMC_CORGL Fumarate hydratase class II OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fumC PE=3 SV=1 1 457 3.0E-134
sp|Q7V024|FUMC_PROMP Fumarate hydratase class II OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fumC PE=3 SV=1 7 465 5.0E-134
sp|Q9FBN6|FUMC_STRCO Fumarate hydratase class II OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fumC PE=3 SV=1 7 467 2.0E-130
sp|Q8FQP8|FUMC_COREF Fumarate hydratase class II OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=fumC PE=3 SV=2 1 457 3.0E-129
sp|Q87DC2|FUMC_XYLFT Fumarate hydratase class II OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fumC PE=3 SV=1 5 461 2.0E-126
sp|P9WN93|FUMC_MYCTU Fumarate hydratase class II OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fumC PE=1 SV=1 7 446 2.0E-126
sp|P9WN92|FUMC_MYCTO Fumarate hydratase class II OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fumC PE=3 SV=1 7 446 2.0E-126
sp|Q7U0N6|FUMC_MYCBO Fumarate hydratase class II OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fumC PE=3 SV=1 7 446 2.0E-126
sp|Q9PD25|FUMC_XYLFA Fumarate hydratase class II OS=Xylella fastidiosa (strain 9a5c) GN=fumC PE=3 SV=1 5 461 1.0E-125
sp|Q82ID7|FUMC_STRAW Fumarate hydratase class II OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fumC PE=3 SV=1 7 467 2.0E-120
sp|Q51404|FUMC1_PSEAE Fumarate hydratase class II 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fumC1 PE=3 SV=1 6 462 8.0E-118
sp|P56149|ASPA_HELPY Aspartate ammonia-lyase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=aspA PE=3 SV=1 7 471 4.0E-107
sp|Q9ZLI5|ASPA_HELPJ Aspartate ammonia-lyase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=aspA PE=3 SV=1 7 471 6.0E-107
sp|P26899|ASPA_BACSU Aspartate ammonia-lyase OS=Bacillus subtilis (strain 168) GN=ansB PE=3 SV=2 7 467 1.0E-104
sp|Q9HTD7|ASPA_PSEAE Aspartate ammonia-lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aspA PE=3 SV=1 6 472 9.0E-100
sp|P07346|ASPA_PSEFL Aspartate ammonia-lyase OS=Pseudomonas fluorescens GN=aspA PE=3 SV=1 2 472 1.0E-98
sp|Q59200|ASPA_CORGL Aspartate ammonia-lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aspA PE=3 SV=2 5 467 5.0E-91
sp|P33109|ASPA_SERMA Aspartate ammonia-lyase OS=Serratia marcescens GN=aspA PE=3 SV=1 3 472 4.0E-89
sp|P44324|ASPA_HAEIN Aspartate ammonia-lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aspA PE=3 SV=1 1 472 3.0E-88
sp|P39461|FUMC_SULSO Fumarate hydratase class II OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fumC PE=1 SV=1 43 461 6.0E-88
sp|P0AC40|ASPA_SHIFL Aspartate ammonia-lyase OS=Shigella flexneri GN=aspA PE=3 SV=1 3 472 9.0E-87
sp|P0AC38|ASPA_ECOLI Aspartate ammonia-lyase OS=Escherichia coli (strain K12) GN=aspA PE=1 SV=1 3 472 9.0E-87
sp|P0AC39|ASPA_ECOL6 Aspartate ammonia-lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aspA PE=3 SV=1 3 472 9.0E-87
sp|Q8XDS0|ASPA_ECO57 Aspartate ammonia-lyase OS=Escherichia coli O157:H7 GN=aspA PE=3 SV=2 3 472 9.0E-87
sp|Q9UZ99|PUR8_PYRAB Adenylosuccinate lyase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purB PE=3 SV=1 137 466 7.0E-12
sp|O27580|PUR8_METTH Adenylosuccinate lyase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purB PE=3 SV=1 182 466 4.0E-11
sp|O58582|PUR8_PYRHO Adenylosuccinate lyase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purB PE=3 SV=1 137 466 5.0E-11
sp|O66856|PUR8_AQUAE Adenylosuccinate lyase OS=Aquifex aeolicus (strain VF5) GN=purB PE=3 SV=1 181 470 3.0E-10
sp|Q8KDJ5|ARLY_CHLTE Argininosuccinate lyase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argH PE=3 SV=1 71 463 9.0E-10
sp|Q58339|PUR8_METJA Adenylosuccinate lyase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purB PE=3 SV=1 137 469 3.0E-09
sp|O28041|PUR8_ARCFU Adenylosuccinate lyase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=purB PE=3 SV=1 137 466 6.0E-09
sp|B4S7P9|ARLY_PROA2 Argininosuccinate lyase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=argH PE=3 SV=1 76 468 1.0E-08
sp|B1YJ36|ARLY_EXIS2 Argininosuccinate lyase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=argH PE=3 SV=1 137 348 6.0E-08
sp|B3QN90|ARLY_CHLP8 Argininosuccinate lyase OS=Chlorobaculum parvum (strain NCIB 8327) GN=argH PE=3 SV=1 67 463 1.0E-07
sp|Q81KV8|ARLY_BACAN Argininosuccinate lyase OS=Bacillus anthracis GN=argH-2 PE=3 SV=1 142 461 1.0E-07
sp|C3L913|ARLY_BACAC Argininosuccinate lyase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=argH PE=3 SV=1 142 461 1.0E-07
sp|C3PB96|ARLY_BACAA Argininosuccinate lyase OS=Bacillus anthracis (strain A0248) GN=argH PE=3 SV=1 142 461 1.0E-07
sp|Q6DAQ9|ARLY_PECAS Argininosuccinate lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argH PE=3 SV=1 142 347 2.0E-07
sp|B7JS05|ARLY_BACC0 Argininosuccinate lyase OS=Bacillus cereus (strain AH820) GN=argH PE=3 SV=1 142 461 5.0E-07
sp|C6DI79|ARLY_PECCP Argininosuccinate lyase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=argH PE=3 SV=1 142 347 6.0E-07
sp|Q633G5|ARLY_BACCZ Argininosuccinate lyase OS=Bacillus cereus (strain ZK / E33L) GN=argH PE=3 SV=1 142 461 6.0E-07
sp|B7H6Y4|ARLY_BACC4 Argininosuccinate lyase OS=Bacillus cereus (strain B4264) GN=argH PE=3 SV=1 142 461 6.0E-07
sp|A4WG51|ARLY_ENT38 Argininosuccinate lyase OS=Enterobacter sp. (strain 638) GN=argH PE=3 SV=1 162 347 7.0E-07
sp|C6BTR8|ARLY_DESAD Argininosuccinate lyase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=argH PE=3 SV=1 113 357 7.0E-07
sp|B9LD91|ARLY_CHLSY Argininosuccinate lyase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=argH PE=3 SV=1 142 357 8.0E-07
sp|A9WJR8|ARLY_CHLAA Argininosuccinate lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=argH PE=3 SV=1 142 357 8.0E-07
sp|Q72ZA4|ARLY_BACC1 Argininosuccinate lyase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=argH PE=3 SV=1 142 461 9.0E-07
sp|B7HRS6|ARLY_BACC7 Argininosuccinate lyase OS=Bacillus cereus (strain AH187) GN=argH PE=3 SV=1 142 461 9.0E-07
sp|P74384|PUR8_SYNY3 Adenylosuccinate lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purB PE=3 SV=1 142 351 1.0E-06
sp|A9VKE0|ARLY_BACWK Argininosuccinate lyase OS=Bacillus weihenstephanensis (strain KBAB4) GN=argH PE=3 SV=1 142 461 1.0E-06
sp|Q817C7|ARLY_BACCR Argininosuccinate lyase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argH PE=3 SV=1 142 461 1.0E-06
sp|Q5SLL0|ARLY_THET8 Argininosuccinate lyase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argH PE=1 SV=1 190 443 1.0E-06
sp|A0RJM3|ARLY_BACAH Argininosuccinate lyase OS=Bacillus thuringiensis (strain Al Hakam) GN=argH PE=3 SV=1 142 461 1.0E-06
sp|Q72GZ4|ARLY_THET2 Argininosuccinate lyase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argH PE=3 SV=1 190 443 2.0E-06
sp|Q30YB9|ARLY_DESAG Argininosuccinate lyase OS=Desulfovibrio alaskensis (strain G20) GN=argH PE=3 SV=1 182 357 2.0E-06
sp|B7IK28|ARLY_BACC2 Argininosuccinate lyase OS=Bacillus cereus (strain G9842) GN=argH PE=3 SV=1 142 461 2.0E-06
sp|B5F0U9|ARLY_SALA4 Argininosuccinate lyase OS=Salmonella agona (strain SL483) GN=argH PE=3 SV=1 142 347 2.0E-06
sp|A4IRS2|ARLY_GEOTN Argininosuccinate lyase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=argH PE=3 SV=1 142 351 2.0E-06
sp|Q66G70|ARLY_YERPS Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argH PE=3 SV=1 142 386 2.0E-06
sp|B2JZE4|ARLY_YERPB Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=argH PE=3 SV=1 142 386 2.0E-06
sp|Q0I2U1|ARLY_HAES1 Argininosuccinate lyase OS=Haemophilus somnus (strain 129Pt) GN=argH PE=3 SV=1 162 347 2.0E-06
sp|Q8Z311|ARLY_SALTI Argininosuccinate lyase OS=Salmonella typhi GN=argH PE=3 SV=1 142 386 2.0E-06
sp|A9MHH3|ARLY_SALAR Argininosuccinate lyase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=argH PE=3 SV=1 142 347 2.0E-06
sp|Q929S8|ARLY_LISIN Argininosuccinate lyase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argH PE=3 SV=1 137 348 2.0E-06
sp|Q8ZKL6|ARLY_SALTY Argininosuccinate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argH PE=3 SV=1 142 347 2.0E-06
sp|B4TQH6|ARLY_SALSV Argininosuccinate lyase OS=Salmonella schwarzengrund (strain CVM19633) GN=argH PE=3 SV=1 142 347 2.0E-06
sp|B3GY67|ARLY_ACTP7 Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=argH PE=3 SV=1 169 357 2.0E-06
sp|C1CXS0|ARLY_DEIDV Argininosuccinate lyase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=argH PE=3 SV=1 162 348 2.0E-06
sp|B7LUN5|ARLY_ESCF3 Argininosuccinate lyase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=argH PE=3 SV=1 142 347 2.0E-06
sp|Q6HCP8|ARLY_BACHK Argininosuccinate lyase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argH PE=3 SV=1 142 443 2.0E-06
sp|A8GL81|ARLY_SERP5 Argininosuccinate lyase OS=Serratia proteamaculans (strain 568) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|C0Q476|ARLY_SALPC Argininosuccinate lyase OS=Salmonella paratyphi C (strain RKS4594) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|A9N0H0|ARLY_SALPB Argininosuccinate lyase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|B4T0X1|ARLY_SALNS Argininosuccinate lyase OS=Salmonella newport (strain SL254) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|B4TCQ6|ARLY_SALHS Argininosuccinate lyase OS=Salmonella heidelberg (strain SL476) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|Q57H93|ARLY_SALCH Argininosuccinate lyase OS=Salmonella choleraesuis (strain SC-B67) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|B0BQC2|ARLY_ACTPJ Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=argH PE=3 SV=1 169 357 3.0E-06
sp|B5RF45|ARLY_SALG2 Argininosuccinate lyase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|B5QXQ5|ARLY_SALEP Argininosuccinate lyase OS=Salmonella enteritidis PT4 (strain P125109) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|B5FPX5|ARLY_SALDC Argininosuccinate lyase OS=Salmonella dublin (strain CT_02021853) GN=argH PE=3 SV=1 142 347 3.0E-06
sp|B0UTI4|ARLY_HISS2 Argininosuccinate lyase OS=Histophilus somni (strain 2336) GN=argH PE=3 SV=1 162 347 3.0E-06
sp|A3N1I1|ARLY_ACTP2 Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=argH PE=3 SV=1 169 357 3.0E-06
sp|B2VGA9|ARLY_ERWT9 Argininosuccinate lyase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argH PE=3 SV=1 142 354 4.0E-06
sp|Q9RSE6|PUR8_DEIRA Adenylosuccinate lyase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=purB PE=3 SV=1 189 339 4.0E-06
sp|A2RHL0|ARLY_LACLM Argininosuccinate lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=argH PE=3 SV=1 137 351 4.0E-06
sp|B1JQ59|ARLY_YERPY Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=argH PE=3 SV=1 142 347 4.0E-06
sp|A4TRH3|ARLY_YERPP Argininosuccinate lyase OS=Yersinia pestis (strain Pestoides F) GN=argH PE=3 SV=1 142 347 4.0E-06
sp|Q1CNQ3|ARLY_YERPN Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=argH PE=3 SV=1 142 347 4.0E-06
sp|A9R514|ARLY_YERPG Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=argH PE=3 SV=1 142 347 4.0E-06
sp|Q8ZA88|ARLY_YERPE Argininosuccinate lyase OS=Yersinia pestis GN=argH PE=3 SV=1 142 347 4.0E-06
sp|Q1CBV4|ARLY_YERPA Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=argH PE=3 SV=1 142 347 4.0E-06
sp|A7FD01|ARLY_YERP3 Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argH PE=3 SV=1 142 347 4.0E-06
sp|Q0W7A4|ARLY_METAR Argininosuccinate lyase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=argH PE=3 SV=1 142 372 4.0E-06
sp|A8AKW2|ARLY_CITK8 Argininosuccinate lyase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=argH PE=3 SV=1 162 347 4.0E-06
sp|Q032X5|ARLY_LACLS Argininosuccinate lyase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=argH PE=3 SV=1 137 357 4.0E-06
sp|P63583|ARLY_STAAN Argininosuccinate lyase OS=Staphylococcus aureus (strain N315) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|P63582|ARLY_STAAM Argininosuccinate lyase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|A6QFH1|ARLY_STAAE Argininosuccinate lyase OS=Staphylococcus aureus (strain Newman) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|Q5HHC5|ARLY_STAAC Argininosuccinate lyase OS=Staphylococcus aureus (strain COL) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|A5IRD8|ARLY_STAA9 Argininosuccinate lyase OS=Staphylococcus aureus (strain JH9) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|Q2FZU2|ARLY_STAA8 Argininosuccinate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|A6U067|ARLY_STAA2 Argininosuccinate lyase OS=Staphylococcus aureus (strain JH1) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|A7X0H4|ARLY_STAA1 Argininosuccinate lyase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|Q2YWS5|ARLY_STAAB Argininosuccinate lyase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|Q8NXF3|ARLY_STAAW Argininosuccinate lyase OS=Staphylococcus aureus (strain MW2) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|Q6GAW6|ARLY_STAAS Argininosuccinate lyase OS=Staphylococcus aureus (strain MSSA476) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|B6I5H6|ARLY_ECOSE Argininosuccinate lyase OS=Escherichia coli (strain SE11) GN=argH PE=3 SV=1 142 347 5.0E-06
sp|B7M714|ARLY_ECO8A Argininosuccinate lyase OS=Escherichia coli O8 (strain IAI1) GN=argH PE=3 SV=1 142 347 5.0E-06
sp|B7LA60|ARLY_ECO55 Argininosuccinate lyase OS=Escherichia coli (strain 55989 / EAEC) GN=argH PE=3 SV=1 142 347 5.0E-06
sp|A7ZUH8|ARLY_ECO24 Argininosuccinate lyase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argH PE=3 SV=1 142 347 5.0E-06
sp|Q6GIC8|ARLY_STAAR Argininosuccinate lyase OS=Staphylococcus aureus (strain MRSA252) GN=argH PE=3 SV=1 142 411 5.0E-06
sp|Q31U28|ARLY_SHIBS Argininosuccinate lyase OS=Shigella boydii serotype 4 (strain Sb227) GN=argH PE=3 SV=1 142 347 5.0E-06
sp|B7NFR0|ARLY_ECOLU Argininosuccinate lyase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|P11447|ARLY_ECOLI Argininosuccinate lyase OS=Escherichia coli (strain K12) GN=argH PE=1 SV=3 142 347 6.0E-06
sp|B1IVB8|ARLY_ECOLC Argininosuccinate lyase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|A8A768|ARLY_ECOHS Argininosuccinate lyase OS=Escherichia coli O9:H4 (strain HS) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|B1XBC5|ARLY_ECODH Argininosuccinate lyase OS=Escherichia coli (strain K12 / DH10B) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|C5A0Q9|ARLY_ECOBW Argininosuccinate lyase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|Q8X730|ARLY_ECO57 Argininosuccinate lyase OS=Escherichia coli O157:H7 GN=argH PE=3 SV=1 142 347 6.0E-06
sp|B7NU40|ARLY_ECO7I Argininosuccinate lyase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|P59619|ARLY_SHIFL Argininosuccinate lyase OS=Shigella flexneri GN=argH PE=3 SV=1 142 347 6.0E-06
sp|Q0SY34|ARLY_SHIF8 Argininosuccinate lyase OS=Shigella flexneri serotype 5b (strain 8401) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|Q1R3V1|ARLY_ECOUT Argininosuccinate lyase OS=Escherichia coli (strain UTI89 / UPEC) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|Q8FB96|ARLY_ECOL6 Argininosuccinate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|Q0TAA0|ARLY_ECOL5 Argininosuccinate lyase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|A1AID8|ARLY_ECOK1 Argininosuccinate lyase OS=Escherichia coli O1:K1 / APEC GN=argH PE=3 SV=1 142 347 6.0E-06
sp|B7MR51|ARLY_ECO81 Argininosuccinate lyase OS=Escherichia coli O81 (strain ED1a) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|B7MI96|ARLY_ECO45 Argininosuccinate lyase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|B7UNT6|ARLY_ECO27 Argininosuccinate lyase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|B2TWF5|ARLY_SHIB3 Argininosuccinate lyase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|Q71XS3|ARLY_LISMF Argininosuccinate lyase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argH PE=3 SV=1 137 348 6.0E-06
sp|O42889|YBN5_SCHPO Uncharacterized protein C8E4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.05c PE=3 SV=1 136 466 6.0E-06
sp|Q3YV16|ARLY_SHISS Argininosuccinate lyase OS=Shigella sonnei (strain Ss046) GN=argH PE=3 SV=1 142 347 6.0E-06
sp|Q1IWM5|ARLY_DEIGD Argininosuccinate lyase OS=Deinococcus geothermalis (strain DSM 11300) GN=argH PE=3 SV=1 162 348 6.0E-06
sp|C1KX44|ARLY_LISMC Argininosuccinate lyase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=argH PE=3 SV=1 137 348 7.0E-06
sp|B5Z062|ARLY_ECO5E Argininosuccinate lyase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=argH PE=3 SV=1 142 347 7.0E-06
sp|B8DH27|ARLY_LISMH Argininosuccinate lyase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=argH PE=3 SV=1 137 348 7.0E-06
sp|Q8Y5H1|ARLY_LISMO Argininosuccinate lyase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argH PE=3 SV=1 137 348 7.0E-06
sp|Q2RG68|ARLY_MOOTA Argininosuccinate lyase OS=Moorella thermoacetica (strain ATCC 39073) GN=argH PE=3 SV=1 162 348 8.0E-06
sp|P57909|ARLY_PASMU Argininosuccinate lyase OS=Pasteurella multocida (strain Pm70) GN=argH PE=3 SV=1 156 347 8.0E-06
sp|B5XZ16|ARLY_KLEP3 Argininosuccinate lyase OS=Klebsiella pneumoniae (strain 342) GN=argH PE=3 SV=1 162 347 9.0E-06
sp|B5BJN4|ARLY_SALPK Argininosuccinate lyase OS=Salmonella paratyphi A (strain AKU_12601) GN=argH PE=3 SV=1 142 347 9.0E-06
sp|Q5PK73|ARLY_SALPA Argininosuccinate lyase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=argH PE=3 SV=1 142 347 9.0E-06
sp|B8GD12|ARLY_CHLAD Argininosuccinate lyase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=argH PE=3 SV=1 142 357 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0006099 tricarboxylic acid cycle Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5732
MTAGKTRTESDAFGEIQVPADKYWGAQTERSLENFRINQPQDRMPEPVVRAFGILKGAAARVNMDYGLDAKIGGA
IQQAAKEVAEGKLVEHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGRMGSKTPVHPNDDVNRSASSNDTFPTV
MHIAGVLELEGELLPALRRLRQALQSKVEEFEGRNIIKIGRTHLQDATPLTLAQEFSGYVAQLDSAAKRVEASLP
DLRLLAQGGTAVGTGINTFVGFAEGVAAEVSRMTGTQFRTAPNKFEALAAHDAVVQAHGSLNTLAASLTKIAQDV
RYLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQCEALTMVCAQVMGNNVATTIGGMNGQFELNVYKPLLIRNLL
HSSRLLADGMRSFERNLVAGLEANEERIGHIMKESLMLVTCLNPKIGYDMASKVAKNAHKKGLTLKQSALELKAL
TEEEFDELVKPELMIGPKPYKA*
Coding >OphauB2|5732
ATGACGGCGGGCAAGACTCGGACGGAAAGCGATGCCTTTGGCGAGATCCAGGTGCCGGCGGACAAGTACTGGGGC
GCACAAACCGAACGGTCGCTGGAGAACTTTCGCATCAACCAGCCGCAGGACCGGATGCCGGAGCCCGTGGTCAGG
GCGTTTGGCATCCTCAAGGGCGCTGCGGCCAGGGTCAACATGGACTACGGGCTGGATGCAAAGATTGGAGGCGCC
ATCCAGCAGGCAGCCAAGGAGGTGGCCGAGGGCAAGCTGGTGGAGCACTTTCCGCTGGTTGTGTGGCAGACGGGC
TCGGGCACGCAGTCCAACATGAATGCAAACGAAGTCATTTCCAACAGGGCCATTGAGATTCTGGGGGGGCGGATG
GGCAGCAAGACTCCGGTGCATCCCAACGACGACGTGAACCGCAGCGCATCGTCCAACGATACGTTTCCCACGGTG
ATGCACATTGCGGGGGTGCTGGAGCTGGAGGGCGAGCTGCTGCCGGCACTGCGCAGGCTACGGCAGGCACTGCAG
AGCAAGGTGGAGGAGTTTGAAGGACGCAACATCATCAAGATTGGGCGGACGCATTTGCAAGACGCCACGCCTCTG
ACACTGGCTCAAGAATTCTCGGGCTACGTGGCACAGCTCGACTCGGCGGCCAAGCGAGTCGAGGCTTCGCTGCCG
GATTTGCGGCTGCTGGCGCAGGGCGGCACGGCGGTGGGCACGGGCATCAATACGTTTGTGGGCTTTGCCGAGGGT
GTTGCGGCCGAGGTGAGCCGGATGACGGGCACGCAGTTCCGCACAGCGCCCAACAAGTTTGAGGCGCTGGCGGCG
CACGATGCCGTGGTGCAGGCGCACGGCAGTCTCAACACACTGGCGGCATCGCTGACCAAGATTGCGCAAGACGTG
CGATACCTGGGCAGCGGGCCGCGCTGCGGGCTGGGCGAGCTGGTGCTGCCGGAGAACGAGCCGGGCAGCAGCATC
ATGCCGGGCAAGGTCAACCCGACGCAGTGCGAGGCGCTGACCATGGTGTGCGCGCAAGTCATGGGCAACAATGTG
GCGACGACAATTGGCGGCATGAATGGGCAGTTTGAGCTCAATGTCTACAAGCCGCTGCTTATCCGCAACCTGCTG
CACAGCTCGCGCCTGCTGGCTGACGGCATGCGCTCCTTTGAGCGCAATCTGGTGGCGGGCCTCGAGGCCAACGAG
GAGAGGATTGGCCACATCATGAAGGAGTCACTCATGCTGGTGACATGCCTCAATCCCAAGATTGGCTACGACATG
GCCAGCAAGGTGGCCAAGAATGCGCATAAAAAGGGTTTGACGCTCAAGCAGAGCGCACTGGAGCTCAAGGCACTG
ACTGAAGAAGAGTTTGACGAGCTAGTCAAACCGGAGCTGATGATTGGGCCCAAGCCTTACAAGGCGTGA
Transcript >OphauB2|5732
ATGACGGCGGGCAAGACTCGGACGGAAAGCGATGCCTTTGGCGAGATCCAGGTGCCGGCGGACAAGTACTGGGGC
GCACAAACCGAACGGTCGCTGGAGAACTTTCGCATCAACCAGCCGCAGGACCGGATGCCGGAGCCCGTGGTCAGG
GCGTTTGGCATCCTCAAGGGCGCTGCGGCCAGGGTCAACATGGACTACGGGCTGGATGCAAAGATTGGAGGCGCC
ATCCAGCAGGCAGCCAAGGAGGTGGCCGAGGGCAAGCTGGTGGAGCACTTTCCGCTGGTTGTGTGGCAGACGGGC
TCGGGCACGCAGTCCAACATGAATGCAAACGAAGTCATTTCCAACAGGGCCATTGAGATTCTGGGGGGGCGGATG
GGCAGCAAGACTCCGGTGCATCCCAACGACGACGTGAACCGCAGCGCATCGTCCAACGATACGTTTCCCACGGTG
ATGCACATTGCGGGGGTGCTGGAGCTGGAGGGCGAGCTGCTGCCGGCACTGCGCAGGCTACGGCAGGCACTGCAG
AGCAAGGTGGAGGAGTTTGAAGGACGCAACATCATCAAGATTGGGCGGACGCATTTGCAAGACGCCACGCCTCTG
ACACTGGCTCAAGAATTCTCGGGCTACGTGGCACAGCTCGACTCGGCGGCCAAGCGAGTCGAGGCTTCGCTGCCG
GATTTGCGGCTGCTGGCGCAGGGCGGCACGGCGGTGGGCACGGGCATCAATACGTTTGTGGGCTTTGCCGAGGGT
GTTGCGGCCGAGGTGAGCCGGATGACGGGCACGCAGTTCCGCACAGCGCCCAACAAGTTTGAGGCGCTGGCGGCG
CACGATGCCGTGGTGCAGGCGCACGGCAGTCTCAACACACTGGCGGCATCGCTGACCAAGATTGCGCAAGACGTG
CGATACCTGGGCAGCGGGCCGCGCTGCGGGCTGGGCGAGCTGGTGCTGCCGGAGAACGAGCCGGGCAGCAGCATC
ATGCCGGGCAAGGTCAACCCGACGCAGTGCGAGGCGCTGACCATGGTGTGCGCGCAAGTCATGGGCAACAATGTG
GCGACGACAATTGGCGGCATGAATGGGCAGTTTGAGCTCAATGTCTACAAGCCGCTGCTTATCCGCAACCTGCTG
CACAGCTCGCGCCTGCTGGCTGACGGCATGCGCTCCTTTGAGCGCAATCTGGTGGCGGGCCTCGAGGCCAACGAG
GAGAGGATTGGCCACATCATGAAGGAGTCACTCATGCTGGTGACATGCCTCAATCCCAAGATTGGCTACGACATG
GCCAGCAAGGTGGCCAAGAATGCGCATAAAAAGGGTTTGACGCTCAAGCAGAGCGCACTGGAGCTCAAGGCACTG
ACTGAAGAAGAGTTTGACGAGCTAGTCAAACCGGAGCTGATGATTGGGCCCAAGCCTTACAAGGCGTGA
Gene >OphauB2|5732
ATGACGGCGGGCAAGACTCGGACGGAAAGCGATGCCTTTGGCGAGATCCAGGTGCCGGCGGACAAGTACTGGGGC
GCACAAACCGAACGGTCGCTGGAGAACTTTCGCATCAACCAGCCGCAGGACCGGATGCCGGAGCCCGTGGTCAGG
GCGTTTGGCATCCTCAAGGGCGCTGCGGCCAGGGTCAACATGGACTACGGGCTGGATGCAAAGATTGGAGGCGCC
ATCCAGCAGGCAGCCAAGGAGGTGGCCGAGGGCAAGCTGGTGGAGCACTTTCCGCTGGTTGTGTGGCAGACGGGC
TCGGGCACGCAGTCCAACATGAATGCAAACGAAGTCATTTCCAACAGGGCCATTGAGATTCTGGGGGGGCGGATG
GGCAGCAAGACTCCGGTGCATCCCAACGACGACGTGAACCGCAGCGCATCGTCCAACGATACGTTTCCCACGGTG
ATGCACATTGCGGGGGTGCTGGAGCTGGAGGGCGAGCTGCTGCCGGCACTGCGCAGGCTACGGCAGGCACTGCAG
AGCAAGGTGGAGGAGTTTGAAGGACGCAACATCATCAAGATTGGGCGGACGCATTTGCAAGACGCCACGCCTCTG
ACACTGGCTCAAGAATTCTCGGGCTACGTGGCACAGCTCGACTCGGCGGCCAAGCGAGTCGAGGCTTCGCTGCCG
GATTTGCGGCTGCTGGCGCAGGGCGGCACGGCGGTGGGCACGGGCATCAATACGTTTGTGGGCTTTGCCGAGGGT
GTTGCGGCCGAGGTGAGCCGGATGACGGGCACGCAGTTCCGCACAGCGCCCAACAAGTTTGAGGCGCTGGCGGCG
CACGATGCCGTGGTGCAGGCGCACGGCAGTCTCAACACACTGGCGGCATCGCTGACCAAGATTGCGCAAGACGTG
CGATACCTGGGCAGCGGGCCGCGCTGCGGGCTGGGCGAGCTGGTGCTGCCGGAGAACGAGCCGGGCAGCAGCATC
ATGCCGGGCAAGGTCAACCCGACGCAGTGCGAGGCGCTGACCATGGTGTGCGCGCAAGTCATGGGCAACAATGTG
GCGACGACAATTGGCGGCATGAATGGGCAGTTTGAGCTCAATGTCTACAAGCCGCTGCTTATCCGCAACCTGCTG
CACAGCTCGCGCCTGCTGGCTGACGGCATGCGCTCCTTTGAGCGCAATCTGGTGGCGGGCCTCGAGGCCAACGAG
GAGAGGATTGGCCACATCATGAAGGAGTCGTGAGTTGGACCATGTGTATCAGACAGACGCCCATGTGGAGCGCTA
TGCTAACTCGCGAGGGGGGGGGATTTGCAGACTCATGCTGGTGACATGCCTCAATCCCAAGATTGGCTACGACAT
GGCCAGCAAGGTGGCCAAGAATGCGCATAAAAAGGGTTTGACGCTCAAGCAGAGCGCACTGGAGCTCAAGGCACT
GACTGAAGAAGAGTTTGACGAGCTAGTCAAACCGGAGCTGATGATTGGGCCCAAGCCTTACAAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail