Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5723
Gene name
LocationContig_47:17524..22324
Strand-
Gene length (bp)4800
Transcript length (bp)4626
Coding sequence length (bp)4626
Protein length (aa) 1542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 4.6E-78 1122 1371
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 4.2E-19 126 177
PF13246 Cation_ATPase Cation transport ATPase (P-type) 2.4E-12 771 851
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.2E-08 638 1004

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 9 1386 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 4 1386 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 33 1437 0.0E+00
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 125 1380 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 368 1379 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 9 1386 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 4 1386 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 33 1437 0.0E+00
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 125 1380 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 368 1379 0.0E+00
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 363 1382 0.0E+00
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 352 1387 0.0E+00
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 357 1382 0.0E+00
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 363 1378 0.0E+00
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 352 1378 0.0E+00
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 356 1375 0.0E+00
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 321 1379 0.0E+00
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 357 1382 0.0E+00
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 363 1382 0.0E+00
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 363 1371 0.0E+00
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 321 1379 0.0E+00
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 363 1371 0.0E+00
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 321 1379 0.0E+00
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 267 1382 0.0E+00
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 367 1364 0.0E+00
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 363 1371 0.0E+00
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 354 1379 0.0E+00
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 368 1410 0.0E+00
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 367 1364 0.0E+00
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 367 1364 0.0E+00
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 356 1385 0.0E+00
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 363 1379 0.0E+00
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 363 1379 0.0E+00
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 336 1375 0.0E+00
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 351 1386 0.0E+00
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 351 1339 0.0E+00
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 360 1365 0.0E+00
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 369 1357 3.0E-174
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 331 1371 4.0E-169
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 369 1369 1.0E-163
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 356 1382 8.0E-160
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 356 1371 6.0E-159
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 356 1368 1.0E-155
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 356 1368 1.0E-152
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 759 1387 5.0E-136
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 369 1384 5.0E-133
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 767 1379 2.0E-132
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 766 1460 4.0E-131
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 758 1374 2.0E-125
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 758 1371 1.0E-124
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 768 1368 1.0E-122
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 370 1371 6.0E-101
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 370 1371 3.0E-100
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 371 1371 3.0E-99
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 371 1371 3.0E-98
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 369 1371 2.0E-97
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 369 1371 1.0E-96
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 371 1371 2.0E-96
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 371 1371 5.0E-96
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 371 1371 1.0E-95
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 831 1379 6.0E-77
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 842 1394 2.0E-72
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 369 914 4.0E-67
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 368 765 1.0E-61
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 362 672 1.0E-61
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 359 665 3.0E-59
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 359 667 9.0E-59
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 363 666 5.0E-56
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 368 665 5.0E-47
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 739 914 4.0E-18
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 127 212 1.0E-17
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 128 212 2.0E-17
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 128 212 3.0E-17
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 813 1169 7.0E-16
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 127 212 1.0E-15
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 98 220 9.0E-15
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 98 220 1.0E-14
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 802 1004 1.0E-14
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 802 1158 1.0E-14
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 103 231 2.0E-14
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 103 231 2.0E-14
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 806 1004 2.0E-14
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 818 1004 3.0E-14
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 68 214 7.0E-14
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 806 995 7.0E-14
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 806 995 8.0E-14
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 91 228 2.0E-13
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 806 995 2.0E-13
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 802 1158 3.0E-13
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 812 1122 3.0E-13
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 802 1158 3.0E-13
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 806 1158 4.0E-13
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 124 226 7.0E-13
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 802 1158 1.0E-12
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 802 1158 1.0E-12
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 802 1004 2.0E-12
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 129 215 3.0E-12
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 129 247 5.0E-12
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 749 1122 5.0E-12
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 127 231 6.0E-12
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 122 231 7.0E-12
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 106 217 1.0E-11
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 746 1122 1.0E-11
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 129 228 2.0E-11
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 116 245 2.0E-11
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 129 226 2.0E-11
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 818 1033 2.0E-11
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 129 228 3.0E-11
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 818 1033 3.0E-11
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 818 976 4.0E-11
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 127 228 5.0E-11
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 129 217 5.0E-11
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 802 1004 5.0E-11
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 818 997 6.0E-11
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 129 238 7.0E-11
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 129 217 7.0E-11
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 126 238 2.0E-10
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 126 241 2.0E-10
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 129 288 2.0E-10
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 122 215 2.0E-10
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 126 218 6.0E-10
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 129 228 7.0E-10
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 99 228 7.0E-10
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 806 1033 7.0E-10
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 88 226 1.0E-09
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 126 226 1.0E-09
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 117 228 1.0E-09
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 806 1118 2.0E-09
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 809 1199 2.0E-09
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 132 226 3.0E-09
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 129 211 3.0E-09
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 123 231 3.0E-09
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 123 231 3.0E-09
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 127 221 4.0E-09
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 804 1122 5.0E-09
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 818 973 6.0E-09
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 126 226 7.0E-09
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 126 226 2.0E-08
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 812 1122 7.0E-08
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 818 976 9.0E-08
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 806 972 1.0E-07
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 123 231 2.0E-07
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 818 1033 4.0E-07
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 818 1033 4.0E-07
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 774 979 5.0E-07
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 774 986 1.0E-06
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 129 212 2.0E-06
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 815 979 2.0E-06
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 123 212 4.0E-06
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 129 213 5.0E-06
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 129 212 6.0E-06
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 811 1000 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 159 193 34
2 529 551 22
3 575 597 22
4 1157 1174 17
5 1184 1206 22
6 1237 1259 22
7 1274 1296 22
8 1303 1325 22
9 1335 1357 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5723
MTSSAASGPGPGPGHGSGAGLDNEAAGSGRKIEQTQRSRWATRKMTIKSSHLKRMSLLNRMQQRTPTSDEKMAAP
GADATEPPFTQQDQGEEAADSQGGSDDENSSRSLYFNLALPDDMLLDGHPKQSFPRNKIRTAKYTPLSFVPKNLW
FQFHNVANIFFLFLVILGIFPIFGGVNPGLNAVPLIFIIVVTAIKDAIEDYRRTILDNELNNAPVHRLHHWNNVN
VEEDNVSTWRRFKKANSKFFGSIWHAMESLWSQKAKEARVQRKKHKEMAHDDDEPRQSIETVRTRRSVRESFASP
FHRDSFTSAQEHIQMTPVSSPSPTPANDASVLPDANDAKRAAAVQAMKPDVVNYRHAIEGARFKKDVWKSLQVGD
FVRIYNDDELPADVIILSTSDPDGACYVETKNLDGETNLKVRQALRCGRCLKHARDCERAEFRIDSEAPHPNLYK
YNGAVQWQQPVPGYPNDEAQEMKEPITIDNLLLRGCNLRNTEWVLGVVIFTGHDTKIMMNAGITPSKRARIAREM
NFNVICNFGILLIMCLLSAIINGVAWAKTDASLHYFEFGSIGGSAPTSGFITFWAAIIVFQNLVPISLYITLEIV
RTLQAVFIFNDVEMYYAKIDQPCVPKSWNISDDVGQIEYIFSDKTGTLTQNLMEFKKATINGQPYGEAYTEAQAG
MQKRMGINVEAEAARIQAEIADAKARALRGLRKLNDSPYLHDEDVTFIAPDFVADLSGESGAEQKAAIEEFMLAL
ALCHTVIAERVPGDPPKMAFKAQSPDEEALVATARDMGFTVLGNSGDGINLNVLGEERHYPILNTIEFNSTRKRM
SSIVRMPDGRILLFCKGADSVIYARLKKGEQQQLRRETAEHLEMFAREGLRTLCIAQRELTEQQYQEWKKEHDNA
AAALEEREEKLESVAELIEQHLLLLGGTAIEDRLQDEVPDTIALLGQAGIKLWVLTGDKVETAINIGFSCNLLNN
DMELVHLKVDEDETGETADEAFVQACEKLLDEHLQTFGLRGDDQDLAAAKKSHEPPAPTHGLVIDGFTLRWVLTD
GLKQKFLILCKQCKSVLCCRVSPAQKAAVVAMVKNGLDVMTLSIGDGANDVAMIQEADVGVGIAGVEGRQAAMSS
DYAIAQFRFLQRLMLVHGRWSYRRLAESISNFFYKNMVWTFSIFWFEIFCNFDITYLFDYTYILMFNLLFTSIPV
GVMGVLDQDVSDKVSLAVPELYRRGIERLEWTQRKFWLYMIDGVYQSVMVFFIPYLAFVHSRPLAFSGLGVEDRL
RFGAYIAHPAVLTINGYILLNTSRWDWLMVLIVTLSDLSVFLWTGIYTSFTGSQFFYKTAAQVYGEASFWAIFFI
VPVICLFPRFAIKALQKVYWPYDVDIIREQAKMGKFAYLEAKNGAEASGALETKSHKSRSSDASKKANKHAVPAS
IDEDLRPIYPPSVATRTTTHNRTQDGSDSTNFTANRLSCDRQSLDVPAAARPSVDRARPSYDRMRMSMDRVRPSY
EASCDFTSAARLTRIESSQTQSGGRLKARLRGLSLTKSANY*
Coding >OphauB2|5723
ATGACGAGTTCCGCAGCCTCCGGCCCCGGCCCCGGGCCTGGCCACGGCTCAGGCGCAGGCCTCGATAACGAAGCC
GCCGGCTCGGGACGCAAGATTGAGCAGACGCAACGGTCAAGATGGGCTACGCGCAAAATGACCATCAAGAGCAGT
CATCTCAAGCGCATGTCGCTTCTAAACCGCATGCAACAGCGCACTCCAACCTCGGACGAAAAGATGGCGGCTCCC
GGAGCCGATGCTACTGAGCCTCCCTTTACCCAGCAAGATCAAGGCGAGGAAGCTGCCGACTCGCAAGGTGGCTCA
GACGATGAGAATAGTAGCCGCTCTCTCTACTTCAACCTGGCCCTTCCCGACGATATGCTGCTCGACGGTCATCCC
AAGCAGAGTTTCCCCCGAAACAAAATCAGAACGGCAAAATATACGCCCCTGTCATTTGTTCCAAAGAACCTCTGG
TTTCAATTTCACAATGTGGCCAACATTTTCTTCCTCTTTCTTGTCATTCTTGGTATCTTCCCCATATTTGGCGGC
GTCAATCCCGGTCTCAACGCCGTTCCGCTTATATTCATCATCGTTGTGACGGCTATCAAGGACGCCATAGAAGAC
TACCGAAGAACCATTCTTGACAATGAGCTCAACAATGCACCTGTTCATCGCCTGCACCATTGGAACAATGTCAAT
GTCGAGGAGGACAATGTGTCGACGTGGCGTAGGTTCAAAAAGGCCAATTCCAAGTTTTTTGGCTCCATCTGGCAT
GCCATGGAGAGTCTTTGGTCCCAAAAAGCAAAAGAAGCCCGAGTGCAGCGTAAGAAGCACAAGGAGATGGCCCAT
GACGACGACGAGCCTCGACAATCGATTGAGACTGTACGGACAAGAAGATCAGTGCGAGAGTCTTTTGCGTCGCCC
TTTCACAGAGACTCCTTTACATCTGCGCAAGAGCACATACAAATGACTCCTGTTTCGTCGCCCAGCCCGACACCG
GCAAACGACGCGTCGGTGCTCCCGGATGCCAACGATGCCAAGCGTGCTGCTGCGGTACAGGCAATGAAGCCTGAT
GTTGTGAATTATCGGCACGCGATTGAGGGCGCGCGCTTCAAAAAGGATGTATGGAAGAGCCTACAGGTGGGCGAT
TTTGTGCGCATCTACAACGACGACGAGCTGCCTGCCGATGTCATCATCCTGTCGACGTCGGATCCCGACGGGGCG
TGCTATGTGGAGACGAAAAACTTGGACGGCGAAACCAATCTCAAGGTGCGGCAGGCTCTTCGCTGCGGCCGATGT
CTCAAGCACGCCCGAGACTGCGAGCGGGCCGAGTTCAGGATTGACAGCGAAGCCCCTCATCCCAACCTGTACAAG
TACAATGGAGCTGTGCAATGGCAGCAGCCCGTGCCCGGCTACCCCAACGACGAGGCGCAAGAGATGAAGGAGCCC
ATCACCATTGACAATTTGCTGCTGCGAGGCTGCAATCTCCGCAACACGGAATGGGTGCTTGGCGTCGTGATATTC
ACTGGACACGACACAAAAATCATGATGAATGCCGGCATTACACCGAGCAAACGCGCTCGGATTGCTCGCGAGATG
AACTTCAACGTGATATGCAACTTTGGCATCCTCCTCATCATGTGCCTCTTGTCGGCCATTATTAATGGCGTGGCC
TGGGCCAAGACGGATGCTTCGTTGCATTACTTTGAGTTTGGCTCTATTGGCGGCAGCGCTCCGACGAGCGGCTTC
ATTACCTTTTGGGCGGCCATTATTGTCTTTCAAAATCTTGTGCCCATCTCGCTCTACATTACACTGGAGATTGTG
CGCACGCTACAGGCCGTCTTCATCTTCAATGACGTTGAGATGTACTATGCCAAGATTGATCAGCCCTGCGTCCCC
AAGTCGTGGAACATATCAGACGACGTGGGCCAGATTGAATACATCTTTTCGGACAAGACGGGCACCCTGACGCAG
AATCTCATGGAGTTCAAAAAGGCAACCATCAACGGCCAGCCGTATGGAGAGGCCTACACGGAGGCGCAGGCCGGC
ATGCAGAAGCGAATGGGCATTAATGTCGAGGCCGAGGCTGCGCGCATACAGGCTGAAATTGCTGATGCCAAGGCT
CGTGCTCTGCGAGGCCTGCGCAAGCTGAATGACAGCCCCTACCTGCACGATGAAGACGTCACCTTTATTGCGCCC
GACTTTGTGGCGGATCTGTCTGGCGAATCCGGAGCGGAGCAAAAGGCGGCCATTGAAGAGTTTATGCTGGCCCTG
GCGCTGTGTCACACCGTCATTGCCGAAAGGGTGCCTGGTGATCCGCCCAAGATGGCATTCAAGGCGCAATCGCCC
GACGAGGAGGCTCTGGTGGCCACTGCTCGCGACATGGGCTTCACGGTGCTTGGCAACTCTGGGGATGGCATTAAC
CTCAATGTGCTGGGCGAGGAACGCCACTATCCCATTCTCAACACGATTGAGTTCAACTCGACGAGGAAGCGCATG
AGCTCCATTGTGCGCATGCCCGACGGCCGCATCTTGTTGTTTTGCAAGGGGGCCGATTCGGTCATCTATGCGCGG
CTAAAAAAGGGCGAGCAGCAGCAGCTGAGGAGAGAGACGGCGGAGCACCTTGAAATGTTTGCCCGTGAAGGCTTG
CGCACGCTGTGCATTGCCCAGCGCGAGTTGACGGAACAGCAGTACCAAGAGTGGAAAAAGGAGCACGACAATGCC
GCTGCGGCTCTCGAAGAGCGTGAAGAAAAGCTTGAAAGCGTGGCTGAGCTCATTGAGCAGCATCTTTTGCTGTTG
GGAGGCACGGCCATTGAGGATCGACTGCAGGACGAGGTTCCCGACACCATTGCCCTGCTTGGCCAGGCTGGCATC
AAGCTGTGGGTGCTGACGGGCGACAAGGTGGAAACGGCAATCAATATTGGCTTCTCGTGCAACCTGCTCAACAAC
GACATGGAGCTGGTACATCTCAAGGTTGACGAGGACGAGACTGGCGAGACGGCCGACGAGGCCTTTGTGCAGGCC
TGTGAAAAACTACTAGACGAGCATCTGCAGACGTTTGGCCTAAGGGGCGACGACCAAGACTTGGCGGCGGCCAAG
AAGAGCCATGAGCCACCGGCGCCGACGCATGGGCTGGTCATTGACGGCTTCACCCTGCGCTGGGTGCTCACGGAT
GGCCTCAAGCAAAAGTTTTTAATCTTGTGCAAGCAGTGCAAGTCGGTTCTGTGCTGCCGCGTCAGTCCTGCGCAA
AAGGCGGCCGTGGTGGCCATGGTGAAGAATGGACTCGACGTCATGACGCTGTCGATTGGCGACGGGGCCAATGAT
GTCGCCATGATTCAAGAGGCTGATGTCGGCGTGGGCATTGCTGGCGTTGAAGGGCGGCAGGCGGCCATGTCGTCC
GACTACGCCATTGCCCAGTTCCGCTTCCTGCAGCGCTTGATGCTGGTGCACGGCCGATGGTCGTACCGTCGCCTG
GCAGAGAGCATTAGCAATTTCTTCTACAAGAACATGGTGTGGACCTTTAGCATCTTTTGGTTTGAAATTTTTTGC
AACTTTGACATTACCTATCTCTTCGACTACACGTACATTCTCATGTTCAACCTCTTGTTCACGTCGATACCGGTT
GGCGTCATGGGCGTTCTCGACCAGGACGTGTCTGACAAGGTTTCTCTGGCTGTGCCCGAGCTGTATCGGCGCGGA
ATCGAACGGCTTGAATGGACTCAACGCAAGTTTTGGCTCTACATGATTGACGGCGTTTACCAGTCGGTCATGGTC
TTCTTCATCCCTTACCTGGCCTTTGTCCACAGCAGGCCCTTGGCATTCTCGGGCCTGGGGGTGGAAGACCGGCTG
CGCTTTGGAGCCTACATTGCGCACCCGGCAGTGCTGACGATTAATGGCTATATCCTGCTCAACACATCTCGGTGG
GACTGGCTCATGGTGCTCATAGTGACGCTTAGCGACCTGTCTGTCTTTTTGTGGACGGGCATCTACACCTCGTTT
ACCGGCTCGCAGTTTTTCTACAAGACGGCGGCGCAGGTGTATGGCGAGGCCAGCTTCTGGGCCATCTTCTTTATT
GTTCCCGTGATATGCTTGTTCCCGCGCTTTGCCATCAAGGCGTTGCAAAAGGTGTATTGGCCATATGACGTGGAC
ATTATCCGCGAGCAGGCCAAGATGGGCAAGTTTGCCTATCTCGAGGCCAAGAATGGAGCCGAGGCATCGGGCGCC
CTTGAGACCAAGAGCCACAAGTCACGCTCATCGGACGCGTCGAAAAAGGCCAACAAGCACGCGGTGCCGGCCAGC
ATTGACGAGGACCTGCGCCCTATTTACCCGCCGTCGGTGGCGACACGCACAACAACGCACAACCGCACGCAGGAC
GGCAGCGACTCGACAAACTTTACCGCCAACCGACTCTCGTGCGATCGCCAGTCGTTGGATGTTCCTGCCGCGGCA
AGGCCATCGGTTGACCGAGCGCGGCCGTCGTATGATCGCATGCGCATGTCCATGGATCGCGTGCGGCCCAGCTAC
GAGGCCAGTTGCGACTTCACCTCTGCGGCGCGGCTGACGCGAATCGAGTCGAGCCAGACACAAAGCGGCGGGCGA
CTCAAGGCTAGATTACGAGGCCTGTCGCTGACCAAGAGCGCCAATTATTAG
Transcript >OphauB2|5723
ATGACGAGTTCCGCAGCCTCCGGCCCCGGCCCCGGGCCTGGCCACGGCTCAGGCGCAGGCCTCGATAACGAAGCC
GCCGGCTCGGGACGCAAGATTGAGCAGACGCAACGGTCAAGATGGGCTACGCGCAAAATGACCATCAAGAGCAGT
CATCTCAAGCGCATGTCGCTTCTAAACCGCATGCAACAGCGCACTCCAACCTCGGACGAAAAGATGGCGGCTCCC
GGAGCCGATGCTACTGAGCCTCCCTTTACCCAGCAAGATCAAGGCGAGGAAGCTGCCGACTCGCAAGGTGGCTCA
GACGATGAGAATAGTAGCCGCTCTCTCTACTTCAACCTGGCCCTTCCCGACGATATGCTGCTCGACGGTCATCCC
AAGCAGAGTTTCCCCCGAAACAAAATCAGAACGGCAAAATATACGCCCCTGTCATTTGTTCCAAAGAACCTCTGG
TTTCAATTTCACAATGTGGCCAACATTTTCTTCCTCTTTCTTGTCATTCTTGGTATCTTCCCCATATTTGGCGGC
GTCAATCCCGGTCTCAACGCCGTTCCGCTTATATTCATCATCGTTGTGACGGCTATCAAGGACGCCATAGAAGAC
TACCGAAGAACCATTCTTGACAATGAGCTCAACAATGCACCTGTTCATCGCCTGCACCATTGGAACAATGTCAAT
GTCGAGGAGGACAATGTGTCGACGTGGCGTAGGTTCAAAAAGGCCAATTCCAAGTTTTTTGGCTCCATCTGGCAT
GCCATGGAGAGTCTTTGGTCCCAAAAAGCAAAAGAAGCCCGAGTGCAGCGTAAGAAGCACAAGGAGATGGCCCAT
GACGACGACGAGCCTCGACAATCGATTGAGACTGTACGGACAAGAAGATCAGTGCGAGAGTCTTTTGCGTCGCCC
TTTCACAGAGACTCCTTTACATCTGCGCAAGAGCACATACAAATGACTCCTGTTTCGTCGCCCAGCCCGACACCG
GCAAACGACGCGTCGGTGCTCCCGGATGCCAACGATGCCAAGCGTGCTGCTGCGGTACAGGCAATGAAGCCTGAT
GTTGTGAATTATCGGCACGCGATTGAGGGCGCGCGCTTCAAAAAGGATGTATGGAAGAGCCTACAGGTGGGCGAT
TTTGTGCGCATCTACAACGACGACGAGCTGCCTGCCGATGTCATCATCCTGTCGACGTCGGATCCCGACGGGGCG
TGCTATGTGGAGACGAAAAACTTGGACGGCGAAACCAATCTCAAGGTGCGGCAGGCTCTTCGCTGCGGCCGATGT
CTCAAGCACGCCCGAGACTGCGAGCGGGCCGAGTTCAGGATTGACAGCGAAGCCCCTCATCCCAACCTGTACAAG
TACAATGGAGCTGTGCAATGGCAGCAGCCCGTGCCCGGCTACCCCAACGACGAGGCGCAAGAGATGAAGGAGCCC
ATCACCATTGACAATTTGCTGCTGCGAGGCTGCAATCTCCGCAACACGGAATGGGTGCTTGGCGTCGTGATATTC
ACTGGACACGACACAAAAATCATGATGAATGCCGGCATTACACCGAGCAAACGCGCTCGGATTGCTCGCGAGATG
AACTTCAACGTGATATGCAACTTTGGCATCCTCCTCATCATGTGCCTCTTGTCGGCCATTATTAATGGCGTGGCC
TGGGCCAAGACGGATGCTTCGTTGCATTACTTTGAGTTTGGCTCTATTGGCGGCAGCGCTCCGACGAGCGGCTTC
ATTACCTTTTGGGCGGCCATTATTGTCTTTCAAAATCTTGTGCCCATCTCGCTCTACATTACACTGGAGATTGTG
CGCACGCTACAGGCCGTCTTCATCTTCAATGACGTTGAGATGTACTATGCCAAGATTGATCAGCCCTGCGTCCCC
AAGTCGTGGAACATATCAGACGACGTGGGCCAGATTGAATACATCTTTTCGGACAAGACGGGCACCCTGACGCAG
AATCTCATGGAGTTCAAAAAGGCAACCATCAACGGCCAGCCGTATGGAGAGGCCTACACGGAGGCGCAGGCCGGC
ATGCAGAAGCGAATGGGCATTAATGTCGAGGCCGAGGCTGCGCGCATACAGGCTGAAATTGCTGATGCCAAGGCT
CGTGCTCTGCGAGGCCTGCGCAAGCTGAATGACAGCCCCTACCTGCACGATGAAGACGTCACCTTTATTGCGCCC
GACTTTGTGGCGGATCTGTCTGGCGAATCCGGAGCGGAGCAAAAGGCGGCCATTGAAGAGTTTATGCTGGCCCTG
GCGCTGTGTCACACCGTCATTGCCGAAAGGGTGCCTGGTGATCCGCCCAAGATGGCATTCAAGGCGCAATCGCCC
GACGAGGAGGCTCTGGTGGCCACTGCTCGCGACATGGGCTTCACGGTGCTTGGCAACTCTGGGGATGGCATTAAC
CTCAATGTGCTGGGCGAGGAACGCCACTATCCCATTCTCAACACGATTGAGTTCAACTCGACGAGGAAGCGCATG
AGCTCCATTGTGCGCATGCCCGACGGCCGCATCTTGTTGTTTTGCAAGGGGGCCGATTCGGTCATCTATGCGCGG
CTAAAAAAGGGCGAGCAGCAGCAGCTGAGGAGAGAGACGGCGGAGCACCTTGAAATGTTTGCCCGTGAAGGCTTG
CGCACGCTGTGCATTGCCCAGCGCGAGTTGACGGAACAGCAGTACCAAGAGTGGAAAAAGGAGCACGACAATGCC
GCTGCGGCTCTCGAAGAGCGTGAAGAAAAGCTTGAAAGCGTGGCTGAGCTCATTGAGCAGCATCTTTTGCTGTTG
GGAGGCACGGCCATTGAGGATCGACTGCAGGACGAGGTTCCCGACACCATTGCCCTGCTTGGCCAGGCTGGCATC
AAGCTGTGGGTGCTGACGGGCGACAAGGTGGAAACGGCAATCAATATTGGCTTCTCGTGCAACCTGCTCAACAAC
GACATGGAGCTGGTACATCTCAAGGTTGACGAGGACGAGACTGGCGAGACGGCCGACGAGGCCTTTGTGCAGGCC
TGTGAAAAACTACTAGACGAGCATCTGCAGACGTTTGGCCTAAGGGGCGACGACCAAGACTTGGCGGCGGCCAAG
AAGAGCCATGAGCCACCGGCGCCGACGCATGGGCTGGTCATTGACGGCTTCACCCTGCGCTGGGTGCTCACGGAT
GGCCTCAAGCAAAAGTTTTTAATCTTGTGCAAGCAGTGCAAGTCGGTTCTGTGCTGCCGCGTCAGTCCTGCGCAA
AAGGCGGCCGTGGTGGCCATGGTGAAGAATGGACTCGACGTCATGACGCTGTCGATTGGCGACGGGGCCAATGAT
GTCGCCATGATTCAAGAGGCTGATGTCGGCGTGGGCATTGCTGGCGTTGAAGGGCGGCAGGCGGCCATGTCGTCC
GACTACGCCATTGCCCAGTTCCGCTTCCTGCAGCGCTTGATGCTGGTGCACGGCCGATGGTCGTACCGTCGCCTG
GCAGAGAGCATTAGCAATTTCTTCTACAAGAACATGGTGTGGACCTTTAGCATCTTTTGGTTTGAAATTTTTTGC
AACTTTGACATTACCTATCTCTTCGACTACACGTACATTCTCATGTTCAACCTCTTGTTCACGTCGATACCGGTT
GGCGTCATGGGCGTTCTCGACCAGGACGTGTCTGACAAGGTTTCTCTGGCTGTGCCCGAGCTGTATCGGCGCGGA
ATCGAACGGCTTGAATGGACTCAACGCAAGTTTTGGCTCTACATGATTGACGGCGTTTACCAGTCGGTCATGGTC
TTCTTCATCCCTTACCTGGCCTTTGTCCACAGCAGGCCCTTGGCATTCTCGGGCCTGGGGGTGGAAGACCGGCTG
CGCTTTGGAGCCTACATTGCGCACCCGGCAGTGCTGACGATTAATGGCTATATCCTGCTCAACACATCTCGGTGG
GACTGGCTCATGGTGCTCATAGTGACGCTTAGCGACCTGTCTGTCTTTTTGTGGACGGGCATCTACACCTCGTTT
ACCGGCTCGCAGTTTTTCTACAAGACGGCGGCGCAGGTGTATGGCGAGGCCAGCTTCTGGGCCATCTTCTTTATT
GTTCCCGTGATATGCTTGTTCCCGCGCTTTGCCATCAAGGCGTTGCAAAAGGTGTATTGGCCATATGACGTGGAC
ATTATCCGCGAGCAGGCCAAGATGGGCAAGTTTGCCTATCTCGAGGCCAAGAATGGAGCCGAGGCATCGGGCGCC
CTTGAGACCAAGAGCCACAAGTCACGCTCATCGGACGCGTCGAAAAAGGCCAACAAGCACGCGGTGCCGGCCAGC
ATTGACGAGGACCTGCGCCCTATTTACCCGCCGTCGGTGGCGACACGCACAACAACGCACAACCGCACGCAGGAC
GGCAGCGACTCGACAAACTTTACCGCCAACCGACTCTCGTGCGATCGCCAGTCGTTGGATGTTCCTGCCGCGGCA
AGGCCATCGGTTGACCGAGCGCGGCCGTCGTATGATCGCATGCGCATGTCCATGGATCGCGTGCGGCCCAGCTAC
GAGGCCAGTTGCGACTTCACCTCTGCGGCGCGGCTGACGCGAATCGAGTCGAGCCAGACACAAAGCGGCGGGCGA
CTCAAGGCTAGATTACGAGGCCTGTCGCTGACCAAGAGCGCCAATTATTAG
Gene >OphauB2|5723
ATGACGAGTTCCGCAGCCTCCGGCCCCGGCCCCGGGCCTGGCCACGGCTCAGGCGCAGGCCTCGATAACGAAGCC
GCCGGCTCGGGACGCAAGATTGAGCAGACGCAACGGTCAAGATGGGCTACGCGCAAAATGACCATCAAGAGCAGT
CATCTCAAGCGCATGTCGCTTCTAAACCGCATGCAACAGCGCACTCCAACCTCGGACGAAAAGATGGCGGCTCCC
GGAGCCGATGCTACTGAGCCTCCCTTTACCCAGCAAGATCAAGGCGAGGAAGCTGCCGACTCGCAAGGTGGCTCA
GACGATGAGAATAGTAGCCGCTCTCTCTACTTCAACCTGGCCCTTCCCGACGATATGCTGCTCGACGGTCATCCC
AAGCAGAGTTTCCCCCGAAACAAAATCAGAACGGCAAAATATACGCCCCTGTCATTTGTTCCAAAGAACCTCTGG
TTTCAATTTCACAATGTGGCCAACATTTTCTTCCTCTTTCTTGTCATTCTTGGTGTAAGTTGCCCTCTGGCCCGC
GCGCCGACGGCTGTAGACTGAGACTTTGCATACAGATCTTCCCCATATTTGGCGGCGTCAATCCCGGTCTCAACG
CCGTTCCGCTTATATTCATCATCGTTGTGACGGCTATCAAGGACGCCATAGAAGACTACCGAAGAACCATTCTTG
ACAATGAGCTCAACAATGCACCTGTTCATCGCCTGCACCATTGGAACAATGTCAATGTCGAGGAGGACAATGTGT
CGACGTGGCGTAGGTTCAAAAAGGCCAATTCCAAGTTTTTTGGCTCCATCTGGCATGCCATGGAGAGTCTTTGGT
CCCAAAAAGCAAAAGAAGCCCGAGTGCAGCGTAAGAAGCACAAGGAGATGGCCCATGACGACGACGAGCCTCGAC
AATCGATTGAGACTGTACGGACAAGAAGATCAGTGCGAGAGTCTTTTGCGTCGCCCTTTCACAGAGACTCCTTTA
CATCTGCGCAAGAGCACATACAAATGACTCCTGTTTCGTCGCCCAGCCCGACACCGGCAAACGACGCGTCGGTGC
TCCCGGATGCCAACGATGCCAAGCGTGCTGCTGCGGTACAGGCAATGAAGCCTGATGTTGTGAATTATCGGCACG
CGATTGAGGGCGCGCGCTTCAAAAAGGATGTATGGAAGAGCCTACAGGTGGGCGATTTTGTGCGCATCTACAACG
ACGACGAGCTGCCTGCCGATGTCATCATCCTGTCGACGTCGGATCCCGACGGGGCGTGCTATGTGGAGACGAAAA
ACTTGGACGGCGAAACCAATCTCAAGGTGCGGCAGGCTCTTCGCTGCGGCCGATGTCTCAAGCACGCCCGAGACT
GCGAGCGGGCCGAGTTCAGGATTGACAGCGAAGCCCCTCATCCCAACCTGTACAAGTACAATGGAGCTGTGCAAT
GGCAGCAGCCCGTGCCCGGCTACCCCAACGACGAGGCGCAAGAGATGAAGGAGCCCATCACCATTGACAATTTGC
TGCTGCGAGGCTGCAATCTCCGCAACACGGAATGGGTGCTTGGCGTCGTGATATTCACTGGACACGACACAAAAA
TCATGATGAATGCCGGCATTACACCGAGCAAACGCGCTCGGATTGCTCGCGAGATGAACTTCAACGTGATATGCA
ACTTTGGCATCCTCCTCATCATGTGCCTCTTGTCGGCCATTATTAATGGCGTGGCCTGGGCCAAGACGGATGCTT
CGTTGCATTACTTTGAGTTTGGCTCTATTGGCGGCAGCGCTCCGACGAGCGGCTTCATTACCTTTTGGGCGGCCA
TTATTGTCTTTCAAAATCTTGTGCCCATCTCGCTCTACATTACACTGGAGATTGTGCGCACGCTACAGGCCGTCT
TCATCTTCAATGACGTTGAGATGTACTATGCCAAGATTGATCAGCCCTGCGTCCCCAAGTCGTGGAACATATCAG
ACGACGTGGGCCAGATTGAATACATCTTTTCGGACAAGACGGGCACCCTGACGCAGAATCTCATGGAGTTCAAAA
AGGCAACCATCAACGGCCAGCCGTATGGAGAGGCCTACACGGAGGCGCAGGCCGGCATGCAGAAGCGAATGGGCA
TTAATGTCGAGGCCGAGGCTGCGCGCATACAGGCTGAAATTGCTGATGCCAAGGCTCGTGCTCTGCGAGGCCTGC
GCAAGCTGAATGACAGCCCCTACCTGCACGATGAAGACGTCACCTTTATTGCGCCCGACTTTGTGGCGGATCTGT
CTGGCGAATCCGGAGCGGAGCAAAAGGCGGCCATTGAAGAGTTTATGCTGGCCCTGGCGCTGTGTCACACCGTCA
TTGCCGAAAGGGTGCCTGGTGATCCGCCCAAGATGGCATTCAAGGCGCAATCGCCCGACGAGGAGGCTCTGGTGG
CCACTGCTCGCGACATGGGCTTCACGGTGCTTGGCAACTCTGGGGATGGCATTAACCTCAATGTGCTGGGCGAGG
AACGCCACTATCCCATTCTCAACACGATTGAGTTCAACTCGACGAGGAAGCGCATGAGCTCCATTGTGCGCATGC
CCGACGGCCGCATCTTGTTGTTTTGCAAGGGGGCCGATTCGGTCATCTATGCGCGGCTAAAAAAGGGCGAGCAGC
AGCAGCTGAGGAGAGAGACGGCGGAGCACCTTGAAATGTTTGCCCGTGAAGGCTTGCGCACGCTGTGCATTGCCC
AGCGCGAGTTGACGGAACAGCAGTACCAAGAGTGGAAAAAGGAGCACGACAATGCCGCTGCGGCTCTCGAAGAGC
GTGAAGAAAAGCTTGAAAGCGTGGCTGAGCTCATTGAGCAGCATCTTTTGCTGTTGGGAGGCACGGCCATTGAGG
ATCGACTGCAGGACGAGGTTCCCGACACCATTGCCCTGCTTGGCCAGGCTGGCATCAAGCTGTGGGTGCTGACGG
GCGACAAGGTGGAAACGGCAATCAATATTGGCTTCTCGTGCAACCTGCTCAACAACGACATGGAGCTGGTACATC
TCAAGGTTGACGAGGACGAGACTGGCGAGACGGCCGACGAGGCCTTTGTGCAGGCCTGTGAAAAACTACTAGACG
AGCATCTGCAGACGTTTGGCCTAAGGGGCGACGACCAAGACTTGGCGGCGGCCAAGAAGAGCCATGAGCCACCGG
CGCCGACGCATGGGCTGGTCATTGACGGCTTCACCCTGCGCTGGGTGCTCACGGATGGCCTCAAGCAAAAGTTTT
TAATCTTGTGCAAGCAGTGCAAGTCGGTTCTGTGCTGCCGCGTCAGTCCTGCGCAAAAGGCGGCCGTGGTGGCCA
TGGTGAAGAATGGACTCGACGTCATGACGCTGTCGATTGGCGACGGGGCCAATGATGTCGCCATGATTCAAGAGG
CTGATGTCGGCGTGGGCATTGCTGGCGTTGAAGGGCGGCAGGCGGCCATGTCGTCCGACTACGCCATTGCCCAGT
TCCGCTTCCTGCAGCGCTTGATGCTGGTGCACGGCCGATGGTCGTACCGTCGCCTGGCAGAGAGCATTAGCAATT
TCTTCTACAAGAACATGGTGTGGACCTTTAGCATCTTTTGGTTTGAAATTTTTTGCAACTTTGACATTACCTATC
TCTTCGACTACACGTACATTCTCATGTTCAACCTCTTGTTCACGTCGATACCGGTTGGCGTCATGGGCGTTCTCG
ACCAGGACGTGTCTGACAAGGTTTCTCTGGCTGTGCCCGAGCTGTATCGGCGCGGAATCGAACGGCTTGAATGGA
CTCAACGCAAGTTTTGGTAAGCACTGCTGGCTCCGTGAAGAATTTTTTTTTTTTAAAAAAAAAAAAAAAAAAAAA
GAAAAAAGCAACAAGAGAGAAAAGAAGCGGGGCAAGAGAGACTGACGCTGCTGGCCTAGGCTCTACATGATTGAC
GGCGTTTACCAGTCGGTCATGGTCTTCTTCATCCCTTACCTGGCCTTTGTCCACAGCAGGCCCTTGGCATTCTCG
GGCCTGGGGGTGGAAGACCGGCTGCGCTTTGGAGCCTACATTGCGCACCCGGCAGTGCTGACGATTAATGGCTAT
ATCCTGCTCAACACATCTCGGTGGGACTGGCTCATGGTGCTCATAGTGACGCTTAGCGACCTGTCTGTCTTTTTG
TGGACGGGCATCTACACCTCGTTTACCGGCTCGCAGTTTTTCTACAAGACGGCGGCGCAGGTGTATGGCGAGGCC
AGCTTCTGGGCCATCTTCTTTATTGTTCCCGTGATATGCTTGTTCCCGCGCTTTGCCATCAAGGCGTTGCAAAAG
GTGTATTGGCCATATGACGTGGACATTATCCGCGAGCAGGCCAAGATGGGCAAGTTTGCCTATCTCGAGGCCAAG
AATGGAGCCGAGGCATCGGGCGCCCTTGAGACCAAGAGCCACAAGTCACGCTCATCGGACGCGTCGAAAAAGGCC
AACAAGCACGCGGTGCCGGCCAGCATTGACGAGGACCTGCGCCCTATTTACCCGCCGTCGGTGGCGACACGCACA
ACAACGCACAACCGCACGCAGGACGGCAGCGACTCGACAAACTTTACCGCCAACCGACTCTCGTGCGATCGCCAG
TCGTTGGATGTTCCTGCCGCGGCAAGGCCATCGGTTGACCGAGCGCGGCCGTCGTATGATCGCATGCGCATGTCC
ATGGATCGCGTGCGGCCCAGCTACGAGGCCAGTTGCGACTTCACCTCTGCGGCGCGGCTGACGCGAATCGAGTCG
AGCCAGACACAAAGCGGCGGGCGACTCAAGGCTAGATTACGAGGCCTGTCGCTGACCAAGAGCGCCAATTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail