© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|5715 |
| Gene name | |
| Location | Contig_467:168..2100 |
| Strand | + |
| Gene length (bp) | 1932 |
| Transcript length (bp) | 1533 |
| Coding sequence length (bp) | 1533 |
| Protein length (aa) | 511 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF07992 | Pyr_redox_2 | Pyridine nucleotide-disulphide oxidoreductase | 2.0E-66 | 46 | 372 |
| PF02852 | Pyr_redox_dim | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain | 1.2E-38 | 391 | 500 |
| PF00070 | Pyr_redox | Pyridine nucleotide-disulphide oxidoreductase | 7.2E-20 | 219 | 294 |
| PF13450 | NAD_binding_8 | NAD(P)-binding Rossmann-like domain | 2.0E-06 | 50 | 85 |
| PF01134 | GIDA | Glucose inhibited division protein A | 1.1E-07 | 47 | 189 |
| PF12831 | FAD_oxidored | FAD dependent oxidoreductase | 2.0E-09 | 47 | 186 |
| PF00890 | FAD_binding_2 | FAD binding domain | 6.1E-07 | 47 | 83 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O00087|DLDH_SCHPO | Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dld1 PE=2 SV=2 | 18 | 510 | 0.0E+00 |
| sp|P09624|DLDH_YEAST | Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPD1 PE=1 SV=1 | 31 | 509 | 0.0E+00 |
| sp|O17953|DLDH_CAEEL | Dihydrolipoyl dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=dld-1 PE=3 SV=2 | 36 | 509 | 0.0E+00 |
| sp|P09622|DLDH_HUMAN | Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens GN=DLD PE=1 SV=2 | 37 | 510 | 0.0E+00 |
| sp|Q60HG3|DLDH_MACFA | Dihydrolipoyl dehydrogenase, mitochondrial OS=Macaca fascicularis GN=DLD PE=2 SV=1 | 37 | 510 | 0.0E+00 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O00087|DLDH_SCHPO | Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dld1 PE=2 SV=2 | 18 | 510 | 0.0E+00 |
| sp|P09624|DLDH_YEAST | Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPD1 PE=1 SV=1 | 31 | 509 | 0.0E+00 |
| sp|O17953|DLDH_CAEEL | Dihydrolipoyl dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=dld-1 PE=3 SV=2 | 36 | 509 | 0.0E+00 |
| sp|P09622|DLDH_HUMAN | Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens GN=DLD PE=1 SV=2 | 37 | 510 | 0.0E+00 |
| sp|Q60HG3|DLDH_MACFA | Dihydrolipoyl dehydrogenase, mitochondrial OS=Macaca fascicularis GN=DLD PE=2 SV=1 | 37 | 510 | 0.0E+00 |
| sp|Q5R4B1|DLDH_PONAB | Dihydrolipoyl dehydrogenase, mitochondrial OS=Pongo abelii GN=DLD PE=2 SV=1 | 37 | 510 | 0.0E+00 |
| sp|P09623|DLDH_PIG | Dihydrolipoyl dehydrogenase, mitochondrial OS=Sus scrofa GN=DLD PE=1 SV=1 | 37 | 510 | 0.0E+00 |
| sp|P49819|DLDH_CANLF | Dihydrolipoyl dehydrogenase, mitochondrial OS=Canis lupus familiaris GN=DLD PE=1 SV=1 | 37 | 510 | 0.0E+00 |
| sp|Q8CIZ7|DLDH_CRIGR | Dihydrolipoyl dehydrogenase, mitochondrial OS=Cricetulus griseus GN=DLD PE=2 SV=1 | 37 | 510 | 0.0E+00 |
| sp|O08749|DLDH_MOUSE | Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus GN=Dld PE=1 SV=2 | 8 | 510 | 0.0E+00 |
| sp|Q6P6R2|DLDH_RAT | Dihydrolipoyl dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Dld PE=1 SV=1 | 37 | 510 | 0.0E+00 |
| sp|Q811C4|DLDH_MESAU | Dihydrolipoyl dehydrogenase, mitochondrial (Fragment) OS=Mesocricetus auratus GN=DLD PE=1 SV=1 | 37 | 497 | 0.0E+00 |
| sp|Q9M5K3|DLDH1_ARATH | Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=LPD1 PE=1 SV=2 | 35 | 510 | 0.0E+00 |
| sp|P31023|DLDH_PEA | Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2 | 36 | 510 | 0.0E+00 |
| sp|Q9M5K2|DLDH2_ARATH | Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=LPD2 PE=1 SV=1 | 17 | 510 | 0.0E+00 |
| sp|O18480|DLDH_MANSE | Dihydrolipoyl dehydrogenase OS=Manduca sexta PE=2 SV=1 | 36 | 510 | 1.0E-180 |
| sp|Q9SPB1|LEGRE_VIGUN | Leghemoglobin reductase OS=Vigna unguiculata GN=FLBR PE=1 SV=1 | 37 | 506 | 6.0E-178 |
| sp|Q41219|LEGRE_SOYBN | Leghemoglobin reductase OS=Glycine max GN=FLBR PE=1 SV=1 | 32 | 506 | 4.0E-174 |
| sp|Q54EW8|DLDH_DICDI | Dihydrolipoyl dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=lpd PE=3 SV=1 | 60 | 510 | 7.0E-174 |
| sp|Q9HUY1|DLDH3_PSEAE | Dihydrolipoyl dehydrogenase 3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpd3 PE=3 SV=1 | 47 | 509 | 1.0E-164 |
| sp|P31046|DLDH3_PSEPU | Dihydrolipoyl dehydrogenase 3 OS=Pseudomonas putida GN=lpd3 PE=1 SV=1 | 47 | 510 | 3.0E-163 |
| sp|P90597|DLDH_TRYCR | Dihydrolipoyl dehydrogenase OS=Trypanosoma cruzi GN=LPD PE=1 SV=1 | 60 | 510 | 3.0E-152 |
| sp|P95596|DLDH_RHOCA | Dihydrolipoyl dehydrogenase OS=Rhodobacter capsulatus GN=lpd PE=3 SV=1 | 58 | 509 | 6.0E-151 |
| sp|Q04933|DLDH_TRYBB | Dihydrolipoyl dehydrogenase OS=Trypanosoma brucei brucei PE=3 SV=1 | 60 | 510 | 2.0E-148 |
| sp|P52992|DLDH_CUPNH | Dihydrolipoyl dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=odhL PE=3 SV=2 | 42 | 510 | 1.0E-138 |
| sp|P14218|DLDH_PSEFL | Dihydrolipoyl dehydrogenase OS=Pseudomonas fluorescens GN=lpd PE=1 SV=3 | 42 | 510 | 5.0E-131 |
| sp|Q9I3D1|DLDH2_PSEAE | Dihydrolipoyl dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdG PE=3 SV=1 | 42 | 510 | 7.0E-131 |
| sp|P31052|DLDH2_PSEPU | Dihydrolipoyl dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4 | 47 | 509 | 5.0E-130 |
| sp|P18925|DLDH_AZOVI | Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1 | 42 | 509 | 9.0E-129 |
| sp|P11959|DLDH1_GEOSE | Dihydrolipoyl dehydrogenase OS=Geobacillus stearothermophilus GN=pdhD PE=1 SV=2 | 45 | 510 | 9.0E-113 |
| sp|P85207|DLDH_THESS | Dihydrolipoyl dehydrogenase OS=Thermus scotoductus (strain ATCC 700910 / SA-01) GN=lpd PE=1 SV=2 | 47 | 510 | 6.0E-106 |
| sp|P0A0E7|DLDH_STAAW | Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=pdhD PE=3 SV=1 | 45 | 509 | 3.0E-103 |
| sp|P0A0E8|DLDH_STAAU | Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus GN=pdhD PE=3 SV=1 | 45 | 509 | 3.0E-103 |
| sp|Q6GAB8|DLDH_STAAS | Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=pdhD PE=3 SV=1 | 45 | 509 | 3.0E-103 |
| sp|Q6GHY9|DLDH_STAAR | Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=pdhD PE=3 SV=1 | 45 | 509 | 3.0E-103 |
| sp|P99084|DLDH_STAAN | Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain N315) GN=pdhD PE=1 SV=1 | 45 | 509 | 3.0E-103 |
| sp|P0A0E6|DLDH_STAAM | Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhD PE=3 SV=1 | 45 | 509 | 3.0E-103 |
| sp|Q5HGY8|DLDH_STAAC | Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain COL) GN=pdhD PE=3 SV=1 | 45 | 509 | 3.0E-103 |
| sp|P21880|DLDH1_BACSU | Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 | 45 | 510 | 7.0E-103 |
| sp|Q9HN74|DLDH_HALSA | Dihydrolipoyl dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lpdA PE=3 SV=1 | 41 | 509 | 3.0E-100 |
| sp|Q04829|DLDH_HALVD | Dihydrolipoyl dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=lpdA PE=1 SV=3 | 47 | 509 | 7.0E-99 |
| sp|P43784|DLDH_HAEIN | Dihydrolipoyl dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lpdA PE=3 SV=2 | 48 | 500 | 2.0E-96 |
| sp|Q5UWH2|DLDH3_HALMA | Dihydrolipoyl dehydrogenase 3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA3 PE=3 SV=1 | 42 | 509 | 3.0E-96 |
| sp|O50286|DLDH_VIBPA | Dihydrolipoyl dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lpd PE=3 SV=2 | 48 | 500 | 1.0E-93 |
| sp|Q5UYG6|DLDH2_HALMA | Dihydrolipoyl dehydrogenase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA2 PE=3 SV=1 | 47 | 509 | 1.0E-92 |
| sp|Q9KPF6|DLDH_VIBCH | Dihydrolipoyl dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lpd PE=3 SV=1 | 48 | 500 | 2.0E-92 |
| sp|P0A9P3|DLDH_SHIFL | Dihydrolipoyl dehydrogenase OS=Shigella flexneri GN=lpdA PE=3 SV=2 | 48 | 500 | 3.0E-92 |
| sp|P0A9P0|DLDH_ECOLI | Dihydrolipoyl dehydrogenase OS=Escherichia coli (strain K12) GN=lpdA PE=1 SV=2 | 48 | 500 | 3.0E-92 |
| sp|P0A9P1|DLDH_ECOL6 | Dihydrolipoyl dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lpdA PE=3 SV=2 | 48 | 500 | 3.0E-92 |
| sp|P0A9P2|DLDH_ECO57 | Dihydrolipoyl dehydrogenase OS=Escherichia coli O157:H7 GN=lpdA PE=3 SV=2 | 48 | 500 | 3.0E-92 |
| sp|Q9Z773|DLDH_CHLPN | Dihydrolipoyl dehydrogenase OS=Chlamydia pneumoniae GN=lpdA PE=3 SV=1 | 42 | 510 | 9.0E-92 |
| sp|O84561|DLDH_CHLTR | Dihydrolipoyl dehydrogenase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lpdA PE=3 SV=1 | 47 | 510 | 3.0E-91 |
| sp|Q9PJI3|DLDH_CHLMU | Dihydrolipoyl dehydrogenase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lpdA PE=3 SV=1 | 47 | 510 | 4.0E-90 |
| sp|Q9I1L9|DLDH1_PSEAE | Dihydrolipoyl dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdV PE=1 SV=1 | 47 | 510 | 7.0E-89 |
| sp|Q02733|IRC15_YEAST | Increased recombination centers protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC15 PE=1 SV=1 | 39 | 509 | 2.0E-88 |
| sp|P54533|DLDH2_BACSU | Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=bfmBC PE=3 SV=1 | 42 | 510 | 6.0E-88 |
| sp|P57303|DLDH_BUCAI | Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lpdA PE=3 SV=1 | 48 | 510 | 1.0E-87 |
| sp|Q8NTE1|DLDH_CORGL | Dihydrolipoyl dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=lpd PE=1 SV=1 | 42 | 510 | 7.0E-87 |
| sp|Q8K9T7|DLDH_BUCAP | Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lpdA PE=3 SV=1 | 45 | 500 | 2.0E-85 |
| sp|Q8KCW2|DLDH_CHLTE | Dihydrolipoyl dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lpd PE=3 SV=1 | 41 | 501 | 1.0E-84 |
| sp|O50311|DLDH_CHLP8 | Dihydrolipoyl dehydrogenase OS=Chlorobaculum parvum (strain NCIB 8327) GN=lpd PE=3 SV=2 | 41 | 503 | 1.0E-82 |
| sp|P50970|DLDH_ZYMMO | Dihydrolipoyl dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lpd PE=3 SV=3 | 42 | 510 | 5.0E-82 |
| sp|Q50068|DLDH_MYCLE | Dihydrolipoyl dehydrogenase OS=Mycobacterium leprae (strain TN) GN=lpd PE=3 SV=1 | 47 | 510 | 2.0E-80 |
| sp|P9WHH9|DLDH_MYCTU | Dihydrolipoyl dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpdC PE=1 SV=1 | 47 | 510 | 2.0E-78 |
| sp|P9WHH8|DLDH_MYCTO | Dihydrolipoyl dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpdC PE=3 SV=1 | 47 | 510 | 2.0E-78 |
| sp|P66005|DLDH_MYCBO | Dihydrolipoyl dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lpd PE=3 SV=1 | 47 | 510 | 2.0E-78 |
| sp|O34324|DLDH3_BACSU | Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=acoL PE=3 SV=1 | 66 | 509 | 5.0E-78 |
| sp|O05940|DLDH_RHIEC | Dihydrolipoyl dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lpdA PE=3 SV=2 | 42 | 501 | 5.0E-78 |
| sp|P09063|DLDH1_PSEPU | Dihydrolipoyl dehydrogenase OS=Pseudomonas putida GN=lpdV PE=1 SV=1 | 45 | 510 | 4.0E-76 |
| sp|Q89AQ8|DLDH_BUCBP | Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lpdA PE=3 SV=1 | 45 | 500 | 5.0E-72 |
| sp|P16171|MERA_BACCE | Mercuric reductase OS=Bacillus cereus GN=merA PE=1 SV=1 | 37 | 501 | 5.0E-69 |
| sp|P9WHH5|STHA_MYCTU | Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sthA PE=1 SV=1 | 45 | 506 | 7.0E-69 |
| sp|P9WHH4|STHA_MYCTO | Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sthA PE=3 SV=1 | 45 | 506 | 7.0E-69 |
| sp|A5U665|STHA_MYCTA | Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=sthA PE=3 SV=1 | 45 | 506 | 7.0E-69 |
| sp|C1AFH2|STHA_MYCBT | Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=sthA PE=3 SV=1 | 45 | 506 | 7.0E-69 |
| sp|A1KM51|STHA_MYCBP | Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=sthA PE=3 SV=1 | 45 | 506 | 7.0E-69 |
| sp|P66007|STHA_MYCBO | Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sthA PE=3 SV=1 | 45 | 506 | 7.0E-69 |
| sp|P75393|DLDH_MYCPN | Dihydrolipoyl dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pdhD PE=3 SV=1 | 47 | 494 | 4.0E-68 |
| sp|P30341|MERA_STRLI | Mercuric reductase OS=Streptomyces lividans GN=merA PE=2 SV=1 | 47 | 505 | 6.0E-68 |
| sp|Q1QX78|STHA_CHRSD | Soluble pyridine nucleotide transhydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=sthA PE=3 SV=1 | 47 | 500 | 1.0E-66 |
| sp|Q88KY8|STHA_PSEPK | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain KT2440) GN=sthA PE=3 SV=3 | 47 | 500 | 2.0E-66 |
| sp|A5W6F5|STHA_PSEP1 | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=sthA PE=3 SV=1 | 47 | 500 | 2.0E-66 |
| sp|P0A0E4|MERA_STAES | Mercuric reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=merA PE=3 SV=1 | 47 | 501 | 3.0E-66 |
| sp|P0A0E5|MERA_STAAU | Mercuric reductase OS=Staphylococcus aureus GN=merA PE=3 SV=1 | 47 | 501 | 3.0E-66 |
| sp|B1J606|STHA_PSEPW | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain W619) GN=sthA PE=3 SV=1 | 47 | 500 | 6.0E-66 |
| sp|B0KH90|STHA_PSEPG | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain GB-1) GN=sthA PE=3 SV=1 | 47 | 500 | 1.0E-65 |
| sp|Q1I7F0|STHA_PSEE4 | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas entomophila (strain L48) GN=sthA PE=3 SV=1 | 47 | 500 | 1.0E-65 |
| sp|F4JLP5|PLPD2_ARATH | Dihydrolipoyl dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=LPD2 PE=2 SV=2 | 38 | 498 | 2.0E-64 |
| sp|P47513|DLDH_MYCGE | Dihydrolipoyl dehydrogenase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pdhD PE=3 SV=1 | 45 | 494 | 3.0E-64 |
| sp|A8MS68|PLPD1_ARATH | Dihydrolipoyl dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=LPD1 PE=2 SV=1 | 62 | 498 | 3.0E-64 |
| sp|Q4KFA6|STHA_PSEF5 | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=sthA PE=3 SV=1 | 47 | 500 | 1.0E-63 |
| sp|Q3K9F5|STHA_PSEPF | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=sthA PE=3 SV=1 | 47 | 500 | 6.0E-63 |
| sp|Q2SIP2|STHA_HAHCH | Soluble pyridine nucleotide transhydrogenase OS=Hahella chejuensis (strain KCTC 2396) GN=sthA PE=3 SV=1 | 47 | 501 | 1.0E-62 |
| sp|P72740|DLDH_SYNY3 | Dihydrolipoyl dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lpdA PE=1 SV=3 | 47 | 499 | 2.0E-62 |
| sp|A6V3A6|STHA_PSEA7 | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=sthA PE=3 SV=1 | 47 | 501 | 3.0E-61 |
| sp|A1U1Y5|STHA_MARHV | Soluble pyridine nucleotide transhydrogenase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=sthA PE=3 SV=1 | 47 | 501 | 4.0E-61 |
| sp|C3K4W1|STHA_PSEFS | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=sthA PE=3 SV=1 | 47 | 500 | 4.0E-61 |
| sp|Q9XBQ9|STHA_AZOVI | Soluble pyridine nucleotide transhydrogenase OS=Azotobacter vinelandii GN=sthA PE=1 SV=1 | 47 | 500 | 4.0E-61 |
| sp|C1DR10|STHA_AZOVD | Soluble pyridine nucleotide transhydrogenase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=sthA PE=3 SV=1 | 47 | 500 | 4.0E-61 |
| sp|O05139|STHA_PSEFL | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens GN=sthA PE=1 SV=3 | 47 | 500 | 5.0E-61 |
| sp|P57112|STHA_PSEAE | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sthA PE=1 SV=2 | 47 | 501 | 5.0E-61 |
| sp|Q02PF5|STHA_PSEAB | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|B7UZU5|STHA_PSEA8 | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|B1JQ50|STHA_YERPY | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|Q66G61|STHA_YERPS | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|A4TRG4|STHA_YERPP | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis (strain Pestoides F) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|Q1CNP4|STHA_YERPN | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|A9R6N5|STHA_YERPG | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|Q8ZA97|STHA_YERPE | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|B2JZF3|STHA_YERPB | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|Q1CBU5|STHA_YERPA | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|A7FD10|STHA_YERP3 | Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=sthA PE=3 SV=1 | 47 | 501 | 5.0E-61 |
| sp|A4VMU6|STHA_PSEU5 | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=sthA PE=3 SV=1 | 47 | 501 | 7.0E-61 |
| sp|A1JI37|STHA_YERE8 | Soluble pyridine nucleotide transhydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=sthA PE=3 SV=1 | 47 | 501 | 2.0E-60 |
| sp|A4XSQ1|STHA_PSEMY | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas mendocina (strain ymp) GN=sthA PE=3 SV=1 | 47 | 501 | 2.0E-60 |
| sp|Q48KI8|STHA_PSE14 | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=sthA PE=3 SV=1 | 47 | 500 | 7.0E-60 |
| sp|Q884I6|STHA_PSESM | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=sthA PE=3 SV=3 | 47 | 500 | 1.0E-59 |
| sp|Q6CZB1|STHA_PECAS | Soluble pyridine nucleotide transhydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sthA PE=3 SV=1 | 45 | 501 | 3.0E-59 |
| sp|Q4ZV77|STHA_PSEU2 | Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=sthA PE=3 SV=2 | 47 | 500 | 3.0E-59 |
| sp|A4WG49|STHA_ENT38 | Soluble pyridine nucleotide transhydrogenase OS=Enterobacter sp. (strain 638) GN=sthA PE=3 SV=1 | 41 | 501 | 1.0E-58 |
| sp|Q87KN5|STHA_VIBPA | Soluble pyridine nucleotide transhydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=sthA PE=3 SV=1 | 44 | 501 | 2.0E-57 |
| sp|A8GL77|STHA_SERP5 | Soluble pyridine nucleotide transhydrogenase OS=Serratia proteamaculans (strain 568) GN=sthA PE=3 SV=1 | 47 | 501 | 2.0E-57 |
| sp|B5XZ14|STHA_KLEP3 | Soluble pyridine nucleotide transhydrogenase OS=Klebsiella pneumoniae (strain 342) GN=sthA PE=3 SV=1 | 41 | 501 | 5.0E-57 |
| sp|P17239|MERA_ACIFR | Mercuric reductase OS=Acidithiobacillus ferrooxidans GN=merA PE=1 SV=2 | 34 | 500 | 5.0E-57 |
| sp|A6TGE6|STHA_KLEP7 | Soluble pyridine nucleotide transhydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=sthA PE=3 SV=1 | 41 | 501 | 9.0E-57 |
| sp|C0Q478|STHA_SALPC | Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-56 |
| sp|Q57H91|STHA_SALCH | Soluble pyridine nucleotide transhydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-56 |
| sp|B5REZ6|STHA_SALG2 | Soluble pyridine nucleotide transhydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-56 |
| sp|Q5E212|STHA_VIBF1 | Soluble pyridine nucleotide transhydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=sthA PE=3 SV=2 | 43 | 501 | 1.0E-56 |
| sp|P66008|STHA_SALTY | Soluble pyridine nucleotide transhydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sthA PE=3 SV=2 | 43 | 501 | 1.0E-56 |
| sp|P66009|STHA_SALTI | Soluble pyridine nucleotide transhydrogenase OS=Salmonella typhi GN=sthA PE=3 SV=2 | 43 | 501 | 1.0E-56 |
| sp|B5BJN6|STHA_SALPK | Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-56 |
| sp|A9N0H2|STHA_SALPB | Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-56 |
| sp|Q5PK71|STHA_SALPA | Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-56 |
| sp|B5QXQ7|STHA_SALEP | Soluble pyridine nucleotide transhydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-56 |
| sp|Q7MBG9|STHA_PHOLL | Soluble pyridine nucleotide transhydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=sthA PE=3 SV=1 | 47 | 501 | 2.0E-56 |
| sp|A8AKW0|STHA_CITK8 | Soluble pyridine nucleotide transhydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=sthA PE=3 SV=1 | 43 | 501 | 2.0E-56 |
| sp|Q7MQ83|STHA_VIBVY | Soluble pyridine nucleotide transhydrogenase OS=Vibrio vulnificus (strain YJ016) GN=sthA PE=3 SV=1 | 47 | 501 | 6.0E-56 |
| sp|Q8DD46|STHA_VIBVU | Soluble pyridine nucleotide transhydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=sthA PE=3 SV=1 | 47 | 501 | 6.0E-56 |
| sp|B7MR55|STHA_ECO81 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O81 (strain ED1a) GN=sthA PE=3 SV=1 | 43 | 501 | 2.0E-55 |
| sp|B1LNS2|STHA_ECOSM | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=sthA PE=3 SV=1 | 43 | 501 | 2.0E-55 |
| sp|Q8FB93|STHA_ECOL6 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sthA PE=3 SV=3 | 43 | 501 | 2.0E-55 |
| sp|B4F1H1|STHA_PROMH | Soluble pyridine nucleotide transhydrogenase OS=Proteus mirabilis (strain HI4320) GN=sthA PE=3 SV=1 | 47 | 501 | 3.0E-55 |
| sp|Q83MI1|STHA_SHIFL | Soluble pyridine nucleotide transhydrogenase OS=Shigella flexneri GN=sthA PE=3 SV=1 | 43 | 501 | 3.0E-55 |
| sp|Q0TA96|STHA_ECOL5 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=sthA PE=3 SV=1 | 43 | 501 | 4.0E-55 |
| sp|B7VM91|STHA_VIBTL | Soluble pyridine nucleotide transhydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=sthA PE=3 SV=1 | 41 | 501 | 4.0E-55 |
| sp|Q48A14|STHA_COLP3 | Soluble pyridine nucleotide transhydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=sthA PE=3 SV=1 | 43 | 501 | 5.0E-55 |
| sp|B1IVB6|STHA_ECOLC | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=sthA PE=3 SV=1 | 43 | 501 | 5.0E-55 |
| sp|A8A770|STHA_ECOHS | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=sthA PE=3 SV=1 | 43 | 501 | 5.0E-55 |
| sp|B7LUN3|STHA_ESCF3 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|Q1R3U7|STHA_ECOUT | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B6I5I0|STHA_ECOSE | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain SE11) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B7NFR2|STHA_ECOLU | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|P27306|STHA_ECOLI | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12) GN=sthA PE=1 SV=5 | 43 | 501 | 6.0E-55 |
| sp|A1AIE2|STHA_ECOK1 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O1:K1 / APEC GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B1XBX3|STHA_ECODH | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|C5A0R1|STHA_ECOBW | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B7M718|STHA_ECO8A | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O8 (strain IAI1) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B7NU38|STHA_ECO7I | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B5Z064|STHA_ECO5E | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B7LA64|STHA_ECO55 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B7MIA0|STHA_ECO45 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|B7UNU0|STHA_ECO27 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|A7ZUI2|STHA_ECO24 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=sthA PE=3 SV=1 | 43 | 501 | 6.0E-55 |
| sp|P23189|GSHR_PSEAE | Glutathione reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gor PE=3 SV=1 | 42 | 496 | 7.0E-55 |
| sp|Q43154|GSHRP_SPIOL | Glutathione reductase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=1 | 47 | 496 | 1.0E-54 |
| sp|P00392|MERA_PSEAI | Mercuric reductase OS=Pseudomonas aeruginosa GN=merA PE=1 SV=1 | 48 | 500 | 1.0E-54 |
| sp|B2TWF7|STHA_SHIB3 | Soluble pyridine nucleotide transhydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-54 |
| sp|Q43621|GSHRC_PEA | Glutathione reductase, cytosolic OS=Pisum sativum PE=2 SV=1 | 47 | 496 | 2.0E-54 |
| sp|Q8X727|STHA_ECO57 | Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O157:H7 GN=sthA PE=3 SV=3 | 43 | 501 | 2.0E-54 |
| sp|C3LPZ2|STHA_VIBCM | Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=sthA PE=3 SV=1 | 47 | 501 | 9.0E-54 |
| sp|P50529|STHA_VIBCH | Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=sthA PE=3 SV=2 | 47 | 501 | 9.0E-54 |
| sp|A5F4K5|STHA_VIBC3 | Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=sthA PE=3 SV=1 | 47 | 501 | 9.0E-54 |
| sp|P94188|MERA_ALCSP | Mercuric reductase OS=Alcaligenes sp. GN=merA PE=3 SV=1 | 66 | 504 | 1.0E-53 |
| sp|Q52109|MERA_ACICA | Mercuric reductase OS=Acinetobacter calcoaceticus GN=merA PE=3 SV=1 | 48 | 504 | 2.0E-53 |
| sp|P94702|MERA_ENTAG | Mercuric reductase OS=Enterobacter agglomerans GN=merA PE=3 SV=1 | 48 | 504 | 2.0E-53 |
| sp|O04955|GSHRC_BRARP | Glutathione reductase, cytosolic OS=Brassica rapa subsp. pekinensis GN=GR1 PE=2 SV=2 | 47 | 510 | 4.0E-53 |
| sp|Q2NQZ3|STHA_SODGM | Soluble pyridine nucleotide transhydrogenase OS=Sodalis glossinidius (strain morsitans) GN=sthA PE=3 SV=1 | 45 | 501 | 4.0E-53 |
| sp|P08332|MERA_SHIFL | Mercuric reductase OS=Shigella flexneri GN=merA PE=3 SV=1 | 48 | 500 | 5.0E-53 |
| sp|Q6LLT9|STHA_PHOPR | Soluble pyridine nucleotide transhydrogenase OS=Photobacterium profundum GN=sthA PE=3 SV=1 | 47 | 501 | 6.0E-53 |
| sp|P48642|GSHRC_ORYSJ | Glutathione reductase, cytosolic OS=Oryza sativa subsp. japonica GN=GRC2 PE=2 SV=2 | 43 | 496 | 9.0E-53 |
| sp|A6VW16|STHA_MARMS | Soluble pyridine nucleotide transhydrogenase OS=Marinomonas sp. (strain MWYL1) GN=sthA PE=3 SV=1 | 47 | 501 | 1.0E-52 |
| sp|B2VGA0|STHA_ERWT9 | Soluble pyridine nucleotide transhydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=sthA PE=3 SV=1 | 43 | 501 | 1.0E-52 |
| sp|Q51772|MERA_PSEFL | Mercuric reductase OS=Pseudomonas fluorescens GN=merA PE=3 SV=1 | 48 | 500 | 6.0E-52 |
| sp|P48641|GSHRC_ARATH | Glutathione reductase, cytosolic OS=Arabidopsis thaliana GN=At3g24170 PE=2 SV=1 | 47 | 496 | 2.0E-50 |
| sp|P35484|DLDH_ACHLA | Dihydrolipoyl dehydrogenase (Fragment) OS=Acholeplasma laidlawii GN=pdhD PE=3 SV=1 | 58 | 388 | 9.0E-49 |
| sp|C4K3I8|STHA_HAMD5 | Soluble pyridine nucleotide transhydrogenase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=sthA PE=3 SV=1 | 47 | 501 | 1.0E-48 |
| sp|Q54465|MERA_SHEPU | Mercuric reductase OS=Shewanella putrefaciens GN=merA PE=3 SV=1 | 46 | 500 | 1.0E-47 |
| sp|P77212|RCLA_ECOLI | Probable pyridine nucleotide-disulfide oxidoreductase RclA OS=Escherichia coli (strain K12) GN=rclA PE=2 SV=2 | 49 | 498 | 3.0E-46 |
| sp|P48639|GSHR_BURCE | Glutathione reductase OS=Burkholderia cepacia GN=gor PE=3 SV=1 | 47 | 496 | 5.0E-46 |
| sp|A2TIL1|GSHR_CALJA | Glutathione reductase, mitochondrial OS=Callithrix jacchus GN=GSR PE=2 SV=1 | 47 | 494 | 1.0E-43 |
| sp|P47791|GSHR_MOUSE | Glutathione reductase, mitochondrial OS=Mus musculus GN=Gsr PE=1 SV=3 | 47 | 494 | 2.0E-43 |
| sp|D0VWY5|GASHR_MARGR | Glutathione amide reductase OS=Marichromatium gracile GN=garB PE=1 SV=1 | 47 | 494 | 8.0E-43 |
| sp|P00390|GSHR_HUMAN | Glutathione reductase, mitochondrial OS=Homo sapiens GN=GSR PE=1 SV=2 | 47 | 494 | 2.0E-42 |
| sp|P48638|GSHR_NOSS1 | Glutathione reductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gor PE=3 SV=2 | 45 | 496 | 2.0E-42 |
| sp|Q99MD6|TRXR3_MOUSE | Thioredoxin reductase 3 OS=Mus musculus GN=Txnrd3 PE=1 SV=3 | 80 | 505 | 4.0E-42 |
| sp|P13110|TYTR_TRYCO | Trypanothione reductase OS=Trypanosoma congolense GN=TPR PE=1 SV=1 | 42 | 494 | 7.0E-42 |
| sp|Q873E8|GSHR_NEUCR | Glutathione reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtr-1 PE=3 SV=1 | 39 | 494 | 6.0E-41 |
| sp|Q9JLT4|TRXR2_MOUSE | Thioredoxin reductase 2, mitochondrial OS=Mus musculus GN=Txnrd2 PE=1 SV=4 | 31 | 494 | 1.0E-40 |
| sp|Q9Z0J5|TRXR2_RAT | Thioredoxin reductase 2, mitochondrial OS=Rattus norvegicus GN=Txnrd2 PE=1 SV=3 | 47 | 494 | 2.0E-40 |
| sp|P43783|GSHR_HAEIN | Glutathione reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gor PE=3 SV=1 | 63 | 496 | 3.0E-40 |
| sp|Q86VQ6|TRXR3_HUMAN | Thioredoxin reductase 3 OS=Homo sapiens GN=TXNRD3 PE=1 SV=4 | 80 | 505 | 8.0E-40 |
| sp|P39051|TYTR_TRYBB | Trypanothione reductase OS=Trypanosoma brucei brucei GN=TPR PE=1 SV=1 | 47 | 505 | 1.0E-39 |
| sp|Q6FRV2|GSHR_CANGA | Glutathione reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLR1 PE=3 SV=1 | 37 | 494 | 2.0E-39 |
| sp|P91938|TRXR1_DROME | Thioredoxin reductase 1, mitochondrial OS=Drosophila melanogaster GN=Trxr-1 PE=1 SV=2 | 43 | 505 | 1.0E-38 |
| sp|O62768|TRXR1_BOVIN | Thioredoxin reductase 1, cytoplasmic OS=Bos taurus GN=TXNRD1 PE=2 SV=3 | 77 | 505 | 5.0E-38 |
| sp|P06715|GSHR_ECOLI | Glutathione reductase OS=Escherichia coli (strain K12) GN=gor PE=1 SV=1 | 63 | 496 | 5.0E-38 |
| sp|Q9N2I8|TRXR2_BOVIN | Thioredoxin reductase 2, mitochondrial OS=Bos taurus GN=TXNRD2 PE=1 SV=2 | 47 | 494 | 6.0E-38 |
| sp|Q9JMH6|TRXR1_MOUSE | Thioredoxin reductase 1, cytoplasmic OS=Mus musculus GN=Txnrd1 PE=1 SV=3 | 77 | 505 | 9.0E-38 |
| sp|P78965|GSHR_SCHPO | Glutathione reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgr1 PE=3 SV=2 | 40 | 494 | 1.0E-37 |
| sp|P39040|TYTR_CRIFA | Trypanothione reductase OS=Crithidia fasciculata GN=TPR PE=1 SV=1 | 42 | 494 | 2.0E-37 |
| sp|P28593|TYTR_TRYCR | Trypanothione reductase OS=Trypanosoma cruzi GN=TPR PE=1 SV=1 | 47 | 494 | 2.0E-37 |
| sp|B9A1H3|TRXR1_EMIHU | Thioredoxin reductase SEP1 OS=Emiliania huxleyi GN=SEP1 PE=1 SV=1 | 39 | 496 | 2.0E-37 |
| sp|Q5NVA2|TRXR1_PONAB | Thioredoxin reductase 1, cytoplasmic OS=Pongo abelii GN=TXNRD1 PE=2 SV=3 | 63 | 507 | 3.0E-37 |
| sp|Q9NNW7|TRXR2_HUMAN | Thioredoxin reductase 2, mitochondrial OS=Homo sapiens GN=TXNRD2 PE=1 SV=3 | 60 | 494 | 3.0E-37 |
| sp|O89049|TRXR1_RAT | Thioredoxin reductase 1, cytoplasmic OS=Rattus norvegicus GN=Txnrd1 PE=1 SV=5 | 77 | 505 | 4.0E-37 |
| sp|Q6HA23|GSHR_KLULA | Glutathione reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLR1 PE=1 SV=1 | 47 | 494 | 2.0E-36 |
| sp|Q16881|TRXR1_HUMAN | Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens GN=TXNRD1 PE=1 SV=3 | 63 | 507 | 2.0E-36 |
| sp|P70619|GSHR_RAT | Glutathione reductase (Fragment) OS=Rattus norvegicus GN=Gsr PE=2 SV=2 | 85 | 494 | 4.0E-36 |
| sp|Q9MYY8|TRXR1_PIG | Thioredoxin reductase 1, cytoplasmic OS=Sus scrofa GN=TXNRD1 PE=2 SV=3 | 77 | 507 | 5.0E-36 |
| sp|P41921|GSHR_YEAST | Glutathione reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLR1 PE=1 SV=2 | 37 | 494 | 1.0E-35 |
| sp|Q8T137|GSHR_DICDI | Glutathione reductase OS=Dictyostelium discoideum GN=gsr PE=3 SV=2 | 41 | 494 | 2.0E-35 |
| sp|P80461|GSHRP_TOBAC | Glutathione reductase, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GOR PE=1 SV=1 | 6 | 496 | 2.0E-35 |
| sp|Q25861|TRXR_PLAF5 | Thioredoxin reductase OS=Plasmodium falciparum (isolate FCH-5) GN=TR PE=1 SV=1 | 45 | 505 | 3.0E-35 |
| sp|P9WHH7|LPDA_MYCTU | NAD(P)H dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpdA PE=1 SV=1 | 48 | 500 | 4.0E-35 |
| sp|P9WHH6|LPDA_MYCTO | NAD(P)H dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpdA PE=3 SV=1 | 48 | 500 | 4.0E-35 |
| sp|P61076|TRXR2_PLAF7 | Thioredoxin reductase 2 OS=Plasmodium falciparum (isolate 3D7) GN=trxr2 PE=1 SV=2 | 45 | 505 | 6.0E-35 |
| sp|Q60151|GSHR_STRTR | Glutathione reductase OS=Streptococcus thermophilus GN=gor PE=3 SV=1 | 63 | 496 | 5.0E-34 |
| sp|P27456|GSHRP_PEA | Glutathione reductase, chloroplastic/mitochondrial OS=Pisum sativum GN=GR PE=2 SV=1 | 23 | 496 | 6.0E-34 |
| sp|P39050|TYTR_LEIDO | Trypanothione reductase OS=Leishmania donovani GN=TPR PE=3 SV=1 | 42 | 494 | 8.0E-34 |
| sp|Q6C5H4|GSHR_YARLI | Glutathione reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLR1 PE=3 SV=1 | 47 | 494 | 3.0E-33 |
| sp|Q9VNT5|TRXR2_DROME | Thioredoxin reductase 2, mitochondrial OS=Drosophila melanogaster GN=Trxr-2 PE=2 SV=1 | 35 | 505 | 4.0E-33 |
| sp|Q74ZK4|GSHR_ASHGO | Glutathione reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLR1 PE=3 SV=1 | 63 | 494 | 3.0E-32 |
| sp|Q17745|TRXR1_CAEEL | Thioredoxin reductase 1 OS=Caenorhabditis elegans GN=trxr-1 PE=2 SV=3 | 47 | 496 | 4.0E-32 |
| sp|P42770|GSHRP_ARATH | Glutathione reductase, chloroplastic OS=Arabidopsis thaliana GN=EMB2360 PE=2 SV=1 | 47 | 496 | 4.0E-32 |
| sp|P48640|GSHRP_SOYBN | Glutathione reductase, chloroplastic OS=Glycine max GN=GR PE=2 SV=1 | 47 | 509 | 2.0E-31 |
| sp|P9WHH3|MTR_MYCTU | Mycothione reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtr PE=1 SV=1 | 47 | 501 | 3.0E-30 |
| sp|P9WHH2|MTR_MYCTO | Mycothione reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtr PE=3 SV=1 | 47 | 501 | 3.0E-30 |
| sp|O15770|GSHR_PLAF7 | Glutathione reductase OS=Plasmodium falciparum (isolate 3D7) GN=GR3 PE=2 SV=4 | 47 | 496 | 3.0E-30 |
| sp|Q94655|GSHR_PLAFK | Glutathione reductase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=GR2 PE=1 SV=3 | 47 | 496 | 5.0E-30 |
| sp|Q6BPI1|GSHR_DEBHA | Glutathione reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLR1 PE=3 SV=3 | 47 | 494 | 1.0E-29 |
| sp|P30635|GSHR_CAEEL | Probable glutathione reductase 2 OS=Caenorhabditis elegans GN=trxr-2 PE=3 SV=2 | 34 | 496 | 2.0E-25 |
| sp|P08662|MERA_SERMA | Mercuric reductase (Fragments) OS=Serratia marcescens GN=merA PE=3 SV=2 | 48 | 245 | 7.0E-23 |
| sp|P80647|DLDH_HYMDI | Dihydrolipoyl dehydrogenase (Fragment) OS=Hymenolepis diminuta PE=1 SV=1 | 43 | 93 | 1.0E-15 |
| sp|P71317|STHA_PECCC | Soluble pyridine nucleotide transhydrogenase (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum GN=sthA PE=3 SV=1 | 391 | 501 | 5.0E-15 |
| sp|Q56839|XECC_XANP2 | 2-oxopropyl-CoM reductase, carboxylating OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecC PE=1 SV=1 | 45 | 487 | 6.0E-14 |
| sp|P08655|YMER_STAAU | Uncharacterized 19.7 kDa protein in mercuric resistance operon OS=Staphylococcus aureus PE=4 SV=1 | 386 | 493 | 9.0E-09 |
| sp|P42435|NASD_BACSU | Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 | 45 | 357 | 1.0E-08 |
| sp|P37062|NAPE_ENTFA | NADH peroxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=npr PE=1 SV=2 | 219 | 483 | 2.0E-08 |
| sp|A6TCX6|NORW_KLEP7 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=norW PE=3 SV=1 | 158 | 357 | 5.0E-08 |
| sp|P42454|RURE_ACIAD | Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rubB PE=1 SV=2 | 217 | 397 | 8.0E-08 |
| sp|P08662|MERA_SERMA | Mercuric reductase (Fragments) OS=Serratia marcescens GN=merA PE=3 SV=2 | 357 | 500 | 9.0E-08 |
| sp|Q5HIR6|AHPF_STAAC | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain COL) GN=ahpF PE=3 SV=1 | 47 | 359 | 9.0E-08 |
| sp|O05204|AHPF_STAA8 | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpF PE=3 SV=1 | 47 | 359 | 9.0E-08 |
| sp|B1LNJ8|HCAD_ECOSM | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hcaD PE=3 SV=1 | 145 | 360 | 2.0E-07 |
| sp|B7N6C9|HCAD_ECOLU | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hcaD PE=3 SV=1 | 164 | 360 | 3.0E-07 |
| sp|B7NRJ1|HCAD_ECO7I | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hcaD PE=3 SV=1 | 145 | 360 | 3.0E-07 |
| sp|A4WDR7|NORW_ENT38 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Enterobacter sp. (strain 638) GN=norW PE=3 SV=1 | 212 | 357 | 4.0E-07 |
| sp|B5XVA0|NORW_KLEP3 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae (strain 342) GN=norW PE=3 SV=1 | 158 | 357 | 5.0E-07 |
| sp|P66013|AHPF_STAAW | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MW2) GN=ahpF PE=3 SV=1 | 47 | 359 | 6.0E-07 |
| sp|P99118|AHPF_STAAN | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain N315) GN=ahpF PE=1 SV=1 | 47 | 359 | 6.0E-07 |
| sp|P66012|AHPF_STAAM | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpF PE=3 SV=1 | 47 | 359 | 6.0E-07 |
| sp|Q6GC92|AHPF_STAAS | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MSSA476) GN=ahpF PE=3 SV=1 | 47 | 359 | 7.0E-07 |
| sp|B5Z115|HCAD_ECO5E | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hcaD PE=3 SV=1 | 181 | 360 | 7.0E-07 |
| sp|Q8XA71|HCAD_ECO57 | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 GN=hcaD PE=3 SV=1 | 181 | 360 | 7.0E-07 |
| sp|P75389|NAOX_MYCPN | Probable NADH oxidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=nox PE=3 SV=1 | 201 | 351 | 7.0E-07 |
| sp|Q0VTB0|RURE_ALCBS | Rubredoxin-NAD(+) reductase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rubB PE=1 SV=1 | 217 | 397 | 7.0E-07 |
| sp|P77650|HCAD_ECOLI | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) GN=hcaD PE=1 SV=1 | 145 | 360 | 8.0E-07 |
| sp|B1IVT5|HCAD_ECOLC | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hcaD PE=3 SV=1 | 145 | 360 | 8.0E-07 |
| sp|A8A348|HCAD_ECOHS | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O9:H4 (strain HS) GN=hcaD PE=3 SV=1 | 145 | 360 | 8.0E-07 |
| sp|B1XB17|HCAD_ECODH | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / DH10B) GN=hcaD PE=3 SV=1 | 145 | 360 | 8.0E-07 |
| sp|C4ZXB7|HCAD_ECOBW | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hcaD PE=3 SV=1 | 145 | 360 | 8.0E-07 |
| sp|Q07946|BEDA_PSEPU | Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 | 145 | 363 | 1.0E-06 |
| sp|B6I5B5|HCAD_ECOSE | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SE11) GN=hcaD PE=3 SV=1 | 145 | 360 | 1.0E-06 |
| sp|B7LDD4|HCAD_ECO55 | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain 55989 / EAEC) GN=hcaD PE=3 SV=1 | 145 | 360 | 1.0E-06 |
| sp|Q7N4V5|HCAD_PHOLL | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaD PE=3 SV=1 | 167 | 360 | 1.0E-06 |
| sp|Q6GJR8|AHPF_STAAR | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MRSA252) GN=ahpF PE=3 SV=1 | 47 | 359 | 2.0E-06 |
| sp|B7N6U1|NORW_ECOLU | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=norW PE=3 SV=1 | 217 | 359 | 2.0E-06 |
| sp|A7ZPY5|HCAD_ECO24 | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hcaD PE=3 SV=1 | 145 | 360 | 3.0E-06 |
| sp|Q4L4Y7|CDR_STAHJ | Coenzyme A disulfide reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cdr PE=3 SV=1 | 220 | 358 | 4.0E-06 |
| sp|B6I697|NORW_ECOSE | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 | 217 | 357 | 4.0E-06 |
| sp|D5IGG6|FDR_SPHSX | Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. GN=fdr PE=1 SV=1 | 219 | 357 | 4.0E-06 |
| sp|O32823|TRXB_LISMO | Thioredoxin reductase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxB PE=3 SV=1 | 43 | 358 | 4.0E-06 |
| sp|B7NSJ1|NORW_ECO7I | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 | 217 | 357 | 4.0E-06 |
| sp|Q8CPY8|TRXB_STAES | Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxB PE=3 SV=1 | 47 | 358 | 5.0E-06 |
| sp|Q5HQW4|TRXB_STAEQ | Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxB PE=3 SV=1 | 47 | 358 | 5.0E-06 |
| sp|Q928P3|FENR2_LISIN | Ferredoxin--NADP reductase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2489 PE=3 SV=1 | 44 | 358 | 5.0E-06 |
| sp|Q58065|NAOX_METJA | Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 | 163 | 357 | 6.0E-06 |
| sp|Q3YZ11|HCAD_SHISS | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella sonnei (strain Ss046) GN=hcaD PE=3 SV=1 | 145 | 360 | 6.0E-06 |
| sp|Q8Y4P5|FENR2_LISMO | Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo2390 PE=3 SV=1 | 44 | 358 | 7.0E-06 |
| sp|P37596|NORW_ECOLI | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 | 217 | 357 | 9.0E-06 |
| sp|B1IUW8|NORW_ECOLC | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 | 217 | 357 | 9.0E-06 |
| sp|B1XCN8|NORW_ECODH | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 | 217 | 357 | 9.0E-06 |
| sp|C4ZYV6|NORW_ECOBW | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 | 217 | 357 | 9.0E-06 |
| sp|Q32CL7|NORW_SHIDS | Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 | 217 | 357 | 9.0E-06 |
| sp|B7M9E8|NORW_ECO8A | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 | 217 | 357 | 9.0E-06 |
| sp|B7LEC2|NORW_ECO55 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 | 217 | 357 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0045454 | cell redox homeostasis | Yes |
| GO:0016491 | oxidoreductase activity | Yes |
| GO:0003824 | catalytic activity | No |
| GO:0065008 | regulation of biological quality | No |
| GO:0019725 | cellular homeostasis | No |
| GO:0009987 | cellular process | No |
| GO:0003674 | molecular_function | No |
| GO:0008150 | biological_process | No |
| GO:0050789 | regulation of biological process | No |
| GO:0050794 | regulation of cellular process | No |
| GO:0065007 | biological regulation | No |
| GO:0042592 | homeostatic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 16 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|5715 MLLSNHIIFRRVARSGNWKQSCFRCSIPASALTPWSRGFASVSDEKDLVIIGGGVAGYVAAIKAGQEGMKVTCVE KRTTLGGTCLNVGCIPSKSLLNNSHLYHQILHDTKNRGIEVGNVKLNLANLMKAKDTAVAGLTKGVEFLFKKNGV EYIKGEGTFVNENDIKVALNSGGEVTVRGKNILIATGSESTPFPGLQVDEERVVTSTGALALDDIPRTMIVIGGG IIGLEMASVWSRLGTKVTVVEFLGQIGGPGMDSEIAKATQKVLKKQGLEFKLNTKVVRGDKGDNKIKLEVDAAKG GKPESLDAEVVLVAIGRRPYTKGLGLENIGLELDDRGRVIIDSEYRTKIPHIRCVGDVTFGPMLAHKAEEEAVAV VEYIKKGFGHVNYGCIPSVMYTYPEVAWVGQNEQDLKNAKIPYKVGTFPFSANSRAKTNLDTEGMVKMLADPETD RLLGVHIIGPNAGEMIAEGTLALEYGASSEDIARTCHAHPTLAEAFKEAAMATSSKAIHF* |
| Coding | >OphauB2|5715 ATGCTTCTTAGCAACCATATAATATTTCGACGCGTCGCTCGATCAGGCAACTGGAAACAATCATGCTTTCGTTGT TCTATTCCTGCGTCAGCTCTAACACCATGGAGTCGAGGTTTCGCCTCTGTTTCCGATGAGAAGGATTTAGTCATC ATTGGCGGTGGCGTTGCTGGATACGTTGCTGCAATCAAGGCTGGCCAAGAGGGCATGAAGGTTACCTGTGTTGAG AAACGCACTACGCTTGGCGGAACTTGTCTTAATGTCGGCTGCATTCCCTCAAAATCGCTCCTCAACAACTCCCAC CTATATCATCAGATACTCCACGACACCAAGAATCGCGGCATTGAAGTGGGGAATGTCAAGCTAAATCTTGCTAAT CTTATGAAAGCGAAGGACACTGCAGTTGCCGGTTTAACTAAGGGCGTCGAGTTTCTTTTCAAAAAAAATGGTGTT GAATACATCAAGGGCGAGGGCACCTTTGTGAATGAAAACGACATCAAGGTAGCTCTCAATAGCGGCGGCGAGGTG ACTGTCCGCGGCAAGAACATTCTCATTGCCACAGGCTCTGAGTCAACTCCGTTTCCAGGCCTTCAAGTTGACGAA GAGCGCGTCGTGACGAGCACTGGTGCTCTAGCACTGGATGACATTCCTCGAACTATGATTGTCATTGGCGGGGGG ATCATTGGGCTTGAAATGGCATCTGTCTGGTCGCGTCTAGGCACCAAGGTGACAGTTGTGGAATTTCTTGGTCAG ATTGGAGGACCGGGAATGGACAGCGAGATTGCAAAAGCAACACAAAAAGTTTTAAAGAAGCAGGGTCTCGAATTC AAGCTCAACACCAAGGTGGTTCGTGGAGACAAGGGTGATAACAAGATCAAACTGGAAGTCGACGCCGCCAAAGGT GGCAAGCCCGAAAGTCTGGATGCTGAAGTTGTCCTCGTTGCTATCGGACGGCGACCTTACACCAAAGGACTTGGC CTCGAGAACATTGGATTAGAACTGGACGACCGGGGGCGAGTAATTATCGATTCCGAGTACCGTACCAAGATTCCA CATATCCGCTGCGTGGGTGATGTGACATTTGGTCCAATGCTCGCCCACAAGGCGGAAGAAGAAGCCGTGGCCGTC GTTGAGTACATCAAAAAGGGCTTTGGCCACGTTAATTACGGCTGCATACCTTCGGTCATGTACACATACCCCGAA GTGGCATGGGTAGGCCAAAACGAGCAAGATCTTAAAAACGCGAAAATACCATATAAAGTCGGCACGTTTCCCTTT AGTGCTAATTCGCGCGCCAAAACAAATCTTGACACCGAGGGCATGGTCAAGATGCTAGCAGACCCAGAGACGGAC CGCCTCCTCGGCGTACATATTATCGGTCCTAACGCTGGCGAGATGATTGCTGAAGGCACTTTAGCGTTAGAGTAT GGGGCGTCCTCTGAGGATATTGCACGTACATGTCATGCTCACCCCACGTTAGCCGAGGCCTTTAAAGAGGCCGCC ATGGCTACAAGTTCTAAGGCAATTCACTTTTAA |
| Transcript | >OphauB2|5715 ATGCTTCTTAGCAACCATATAATATTTCGACGCGTCGCTCGATCAGGCAACTGGAAACAATCATGCTTTCGTTGT TCTATTCCTGCGTCAGCTCTAACACCATGGAGTCGAGGTTTCGCCTCTGTTTCCGATGAGAAGGATTTAGTCATC ATTGGCGGTGGCGTTGCTGGATACGTTGCTGCAATCAAGGCTGGCCAAGAGGGCATGAAGGTTACCTGTGTTGAG AAACGCACTACGCTTGGCGGAACTTGTCTTAATGTCGGCTGCATTCCCTCAAAATCGCTCCTCAACAACTCCCAC CTATATCATCAGATACTCCACGACACCAAGAATCGCGGCATTGAAGTGGGGAATGTCAAGCTAAATCTTGCTAAT CTTATGAAAGCGAAGGACACTGCAGTTGCCGGTTTAACTAAGGGCGTCGAGTTTCTTTTCAAAAAAAATGGTGTT GAATACATCAAGGGCGAGGGCACCTTTGTGAATGAAAACGACATCAAGGTAGCTCTCAATAGCGGCGGCGAGGTG ACTGTCCGCGGCAAGAACATTCTCATTGCCACAGGCTCTGAGTCAACTCCGTTTCCAGGCCTTCAAGTTGACGAA GAGCGCGTCGTGACGAGCACTGGTGCTCTAGCACTGGATGACATTCCTCGAACTATGATTGTCATTGGCGGGGGG ATCATTGGGCTTGAAATGGCATCTGTCTGGTCGCGTCTAGGCACCAAGGTGACAGTTGTGGAATTTCTTGGTCAG ATTGGAGGACCGGGAATGGACAGCGAGATTGCAAAAGCAACACAAAAAGTTTTAAAGAAGCAGGGTCTCGAATTC AAGCTCAACACCAAGGTGGTTCGTGGAGACAAGGGTGATAACAAGATCAAACTGGAAGTCGACGCCGCCAAAGGT GGCAAGCCCGAAAGTCTGGATGCTGAAGTTGTCCTCGTTGCTATCGGACGGCGACCTTACACCAAAGGACTTGGC CTCGAGAACATTGGATTAGAACTGGACGACCGGGGGCGAGTAATTATCGATTCCGAGTACCGTACCAAGATTCCA CATATCCGCTGCGTGGGTGATGTGACATTTGGTCCAATGCTCGCCCACAAGGCGGAAGAAGAAGCCGTGGCCGTC GTTGAGTACATCAAAAAGGGCTTTGGCCACGTTAATTACGGCTGCATACCTTCGGTCATGTACACATACCCCGAA GTGGCATGGGTAGGCCAAAACGAGCAAGATCTTAAAAACGCGAAAATACCATATAAAGTCGGCACGTTTCCCTTT AGTGCTAATTCGCGCGCCAAAACAAATCTTGACACCGAGGGCATGGTCAAGATGCTAGCAGACCCAGAGACGGAC CGCCTCCTCGGCGTACATATTATCGGTCCTAACGCTGGCGAGATGATTGCTGAAGGCACTTTAGCGTTAGAGTAT GGGGCGTCCTCTGAGGATATTGCACGTACATGTCATGCTCACCCCACGTTAGCCGAGGCCTTTAAAGAGGCCGCC ATGGCTACAAGTTCTAAGGCAATTCACTTTTAA |
| Gene | >OphauB2|5715 ATGCTTCTTAGCAACCATATAATATTTCGACGCGTCGCTCGATCAGGCAACTGGAAACAATCATGGTAAGTATAC TCCTATTCGAGGCCAATGCTTGGATTAAGATATACCCCTTACTAGGTGAGGGGAAACGCTCTTAGAAGACGGTTG CTAGTGTTCGGCAATTATAAGGAAACTTTGTTGAAGAACTATACCATAAACTACTGCTAACATAATGCCGCGTCA TAGCTTTCGTTGTTCTATTCCTGCGTCAGCTCTAACACCATGGAGTCGAGGTTTCGCCTCTGTTTCCGGTTCGCC CACCGTAATAGATAGACTAAAAACTCCTTAAGCGCTTACACGAACTTACAGATGAGAAGGATTTAGTCATCATTG GCGGTGGCGTTGCTGGATACGTTGCTGCAATCAAGGCTGGCCAAGAGGGCATGAAGGTGTGTTGGCTCGGCGGTG AAAAGATGCCATTTATATAGTTTGGGGCGACTAAGAAATAATTATCAGACTGTTTCGCTGACTATATATATATCT AGGTTACCTGTGTTGAGAAACGCACTACGCTTGGCGGAACTTGTCTTAATGTCGGCTGCATTCCCTCAAAATCGC TCCTCAACAACTCCCACCTATATCATCAGATACTCCACGACACCAAGAATCGCGGCATTGAAGTGGGGAATGTCA AGCTAAATCTTGCTAATCTTATGAAAGCGAAGGACACTGCAGTTGCCGGTTTAACTAAGGGCGTCGAGTTTCTTT TCAAAAAAAATGGTGTTGAATACATCAAGGGCGAGGGCACCTTTGTGAATGAAAACGACATCAAGGTAGCTCTCA ATAGCGGCGGCGAGGTGACTGTCCGCGGCAAGAACATTCTCATTGCCACAGGCTCTGAGTCAACTCCGTTTCCAG GCCTTCAAGTTGACGAAGAGCGCGTCGTGACGAGCACTGGTGCTCTAGCACTGGATGACATTCCTCGAACTATGA TTGTCATTGGCGGGGGGATCATTGGGCTTGAAATGGCATCTGTCTGGTCGCGTCTAGGCACCAAGGTGACAGTTG TGGAATTTCTTGGTCAGATTGGAGGACCGGGAATGGACAGCGAGATTGCAAAAGCAACACAAAAAGTTTTAAAGA AGCAGGGTCTCGAATTCAAGCTCAACACCAAGGTGGTTCGTGGAGACAAGGGTGATAACAAGATCAAACTGGAAG TCGACGCCGCCAAAGGTGGCAAGCCCGAAAGTGTAGGTCATGACGGTGGTGGTGTATTATTAAACCCGCTTTTGG TGTACTCTCGGCTTTTGCTAATATTCGCGGCCCTTCTAGCTGGATGCTGAAGTTGTCCTCGTTGCTATCGGACGG CGACCTTACACCAAAGGACTTGGCCTCGAGAACATTGGATTAGAACTGGACGACCGGGGGCGAGTAATTATCGAT TCCGAGTACCGTACCAAGATTCCACATATCCGCTGCGTGGGTGATGTGACATTTGGTCCAATGCTCGCCCACAAG GCGGAAGAAGAAGCCGTGGCCGTCGTTGAGTACATCAAAAAGGGCTTTGGCCACGTTAATTACGGCTGCATACCT TCGGTCATGTACACATACCCCGAAGTGGCATGGGTAGGCCAAAACGAGCAAGATCTTAAAAACGCGAAAATACCA TATAAAGTCGGCACGTTTCCCTTTAGTGCTAATTCGCGCGCCAAAACAAATCTTGACACCGAGGGCATGGTCAAG ATGCTAGCAGACCCAGAGACGGACCGCCTCCTCGGCGTACATATTATCGGTCCTAACGCTGGCGAGATGATTGCT GAAGGCACTTTAGCGTTAGAGTATGGGGCGTCCTCTGAGGATATTGCACGTACATGTCATGCTCACCCCACGTTA GCCGAGGCCTTTAAAGAGGCCGCCATGGCTACAAGTTCTAAGGCAATTCACTTTTAA |