Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5712
Gene name
LocationContig_461:131..2200
Strand+
Gene length (bp)2069
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02854 MIF4G MIF4G domain 8.5E-15 182 376
PF02847 MA3 MA3 domain 1.1E-09 498 618

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13971|SGD1_SCHPO Suppressor of glycerol defect protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgd1 PE=3 SV=1 178 651 3.0E-69
sp|Q06132|SGD1_YEAST Suppressor of glycerol defect protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGD1 PE=1 SV=1 2 647 6.0E-57
sp|Q3UFM5|NOM1_MOUSE Nucleolar MIF4G domain-containing protein 1 OS=Mus musculus GN=Nom1 PE=1 SV=2 173 661 2.0E-37
sp|Q5C9Z4|NOM1_HUMAN Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens GN=NOM1 PE=1 SV=1 179 664 3.0E-36
sp|Q9W020|NOM1_DROME Nucleolar MIF4G domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG9004 PE=2 SV=1 131 661 5.0E-30

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5712
MRNQLAKDEADIAYYKKKLGIKTGRRCSSTAFKEDGLDTLVVEEEEDICHNLPIKNNKKRKQDYDEWLSAKRSKT
STHWKYWDSVYRKRNQGEAANSSQYGQDSETPKSVLYGEERALYVKENDEFFADFDAYAEDRDSPLPEGRGNPFA
VPLIDVSTASHVVSHRNDVSASHQGNELKLKRQIQGQINRLTDSNILSIVQVVDAIYQQNPRGHVTELLTDAVLA
QICKSDNIPDQFFVLTGGFCAAIYKVIGPSFGSHLLRRVVKDFATQYQRASETNQAHMQKASCNIMSLLTQLYTF
GIVSCRIIFDYMQRLLQQLSEINVELLLRVCRMSGSLLRRDDRERFRHISDDLARAISYANKSDASSRTKFMMET
IQKLSTGKQKIKQVESFGVSEHIVRMRKHLGELKSQSRRLDGLAPMGIGLGDIEGAKEHGKWWLAGASVPNSRGQ
VAMARDMVATRQIRDSLSGEDEEDMNLVLPDFYNKARTQGLTTKAQIAIFTALMTANSHEEGYSQYQNLRLKKDE
QLEIAHVLVQCVGSEAQYNEYYALVAKQACAKNKRIKFAFQDRVWKLLRSLGEPLFGEEMDEDERRNNEGMKDER
RIKHVARFYASLVGNGILSIRILKPLELHEVNKETATFVECFLVSLLRASKRITTSYSRITLVYKN*
Coding >OphauB2|5712
ATGCGCAATCAACTAGCAAAGGACGAGGCCGACATTGCCTACTATAAGAAAAAGCTTGGTATTAAGACGGGGCGC
AGGTGTTCGTCTACGGCCTTTAAAGAAGATGGCTTAGATACTCTGGTTGTCGAAGAAGAGGAAGACATCTGCCAC
AACTTACCAATAAAAAACAACAAGAAGCGCAAACAGGATTACGACGAATGGCTATCTGCGAAAAGGAGTAAAACG
TCAACCCACTGGAAATATTGGGATTCGGTTTATCGTAAAAGGAATCAAGGCGAAGCAGCTAATAGTTCACAATAT
GGCCAGGATTCGGAGACGCCAAAGTCGGTATTATATGGCGAAGAGAGAGCCTTATATGTGAAAGAAAACGATGAA
TTCTTTGCGGATTTTGATGCGTACGCTGAAGACAGAGACTCTCCACTACCTGAGGGTCGAGGAAATCCCTTTGCG
GTCCCTTTGATTGACGTGTCGACTGCTAGTCACGTCGTGTCGCATCGGAATGACGTTTCTGCGTCGCACCAGGGA
AACGAACTTAAGCTAAAGCGGCAGATTCAAGGCCAAATCAACCGTCTTACCGACAGCAATATTCTATCCATTGTT
CAAGTCGTCGACGCTATATACCAACAAAACCCGCGTGGCCATGTCACTGAGCTCTTGACAGACGCGGTTTTGGCA
CAAATCTGCAAGTCAGACAATATCCCTGACCAATTTTTTGTTCTTACAGGGGGCTTTTGCGCTGCAATATACAAG
GTTATTGGGCCTAGCTTTGGATCCCATCTATTGCGCAGGGTCGTCAAAGATTTCGCGACTCAATACCAAAGGGCG
AGTGAAACGAATCAGGCCCACATGCAGAAGGCGTCGTGCAATATCATGTCTTTACTTACACAGCTTTACACGTTT
GGAATTGTGAGCTGTAGGATCATTTTCGATTACATGCAACGGCTACTGCAGCAACTTTCTGAGATTAATGTCGAG
CTATTGTTGCGTGTCTGCCGAATGTCTGGCAGTCTTTTACGACGAGATGATAGGGAGAGATTCCGGCATATCTCA
GACGACCTAGCCAGAGCCATATCATATGCCAACAAATCCGACGCATCTAGCCGGACAAAGTTCATGATGGAGACA
ATTCAAAAACTCAGTACTGGCAAACAGAAGATCAAGCAGGTTGAATCTTTTGGCGTGTCAGAGCATATTGTTCGC
ATGAGAAAACACCTTGGCGAGCTCAAGTCTCAATCCAGAAGGCTTGACGGACTCGCGCCAATGGGTATTGGACTC
GGCGACATCGAAGGTGCTAAAGAGCATGGTAAATGGTGGCTTGCAGGAGCAAGTGTGCCAAACTCCCGTGGACAG
GTTGCCATGGCTAGAGACATGGTGGCAACAAGGCAAATTCGCGACAGTCTAAGCGGTGAAGATGAAGAAGACATG
AATTTGGTCCTGCCCGACTTCTACAACAAGGCACGAACCCAGGGGCTAACAACAAAGGCCCAAATTGCTATCTTT
ACGGCGCTCATGACTGCCAATAGCCATGAGGAAGGCTACAGCCAATATCAGAACCTCAGGCTTAAAAAAGATGAA
CAACTGGAAATTGCACATGTGCTTGTCCAGTGTGTGGGTAGCGAGGCACAGTATAACGAGTACTATGCCTTGGTG
GCGAAGCAGGCGTGCGCAAAAAATAAAAGGATCAAATTCGCCTTCCAAGACCGAGTCTGGAAACTACTTCGCAGC
CTTGGAGAGCCATTATTTGGCGAAGAAATGGACGAGGACGAAAGACGAAACAATGAGGGGATGAAAGATGAGCGG
CGGATAAAGCACGTGGCCCGCTTCTATGCGTCCCTGGTAGGCAATGGCATACTAAGCATTCGCATTCTCAAGCCT
CTCGAGCTACACGAGGTGAATAAGGAGACGGCAACCTTTGTTGAATGCTTCCTCGTCAGCCTCCTTCGAGCCAGC
AAAAGAATTACCACTTCTTATAGCAGGATTACATTGGTTTATAAGAACTAG
Transcript >OphauB2|5712
ATGCGCAATCAACTAGCAAAGGACGAGGCCGACATTGCCTACTATAAGAAAAAGCTTGGTATTAAGACGGGGCGC
AGGTGTTCGTCTACGGCCTTTAAAGAAGATGGCTTAGATACTCTGGTTGTCGAAGAAGAGGAAGACATCTGCCAC
AACTTACCAATAAAAAACAACAAGAAGCGCAAACAGGATTACGACGAATGGCTATCTGCGAAAAGGAGTAAAACG
TCAACCCACTGGAAATATTGGGATTCGGTTTATCGTAAAAGGAATCAAGGCGAAGCAGCTAATAGTTCACAATAT
GGCCAGGATTCGGAGACGCCAAAGTCGGTATTATATGGCGAAGAGAGAGCCTTATATGTGAAAGAAAACGATGAA
TTCTTTGCGGATTTTGATGCGTACGCTGAAGACAGAGACTCTCCACTACCTGAGGGTCGAGGAAATCCCTTTGCG
GTCCCTTTGATTGACGTGTCGACTGCTAGTCACGTCGTGTCGCATCGGAATGACGTTTCTGCGTCGCACCAGGGA
AACGAACTTAAGCTAAAGCGGCAGATTCAAGGCCAAATCAACCGTCTTACCGACAGCAATATTCTATCCATTGTT
CAAGTCGTCGACGCTATATACCAACAAAACCCGCGTGGCCATGTCACTGAGCTCTTGACAGACGCGGTTTTGGCA
CAAATCTGCAAGTCAGACAATATCCCTGACCAATTTTTTGTTCTTACAGGGGGCTTTTGCGCTGCAATATACAAG
GTTATTGGGCCTAGCTTTGGATCCCATCTATTGCGCAGGGTCGTCAAAGATTTCGCGACTCAATACCAAAGGGCG
AGTGAAACGAATCAGGCCCACATGCAGAAGGCGTCGTGCAATATCATGTCTTTACTTACACAGCTTTACACGTTT
GGAATTGTGAGCTGTAGGATCATTTTCGATTACATGCAACGGCTACTGCAGCAACTTTCTGAGATTAATGTCGAG
CTATTGTTGCGTGTCTGCCGAATGTCTGGCAGTCTTTTACGACGAGATGATAGGGAGAGATTCCGGCATATCTCA
GACGACCTAGCCAGAGCCATATCATATGCCAACAAATCCGACGCATCTAGCCGGACAAAGTTCATGATGGAGACA
ATTCAAAAACTCAGTACTGGCAAACAGAAGATCAAGCAGGTTGAATCTTTTGGCGTGTCAGAGCATATTGTTCGC
ATGAGAAAACACCTTGGCGAGCTCAAGTCTCAATCCAGAAGGCTTGACGGACTCGCGCCAATGGGTATTGGACTC
GGCGACATCGAAGGTGCTAAAGAGCATGGTAAATGGTGGCTTGCAGGAGCAAGTGTGCCAAACTCCCGTGGACAG
GTTGCCATGGCTAGAGACATGGTGGCAACAAGGCAAATTCGCGACAGTCTAAGCGGTGAAGATGAAGAAGACATG
AATTTGGTCCTGCCCGACTTCTACAACAAGGCACGAACCCAGGGGCTAACAACAAAGGCCCAAATTGCTATCTTT
ACGGCGCTCATGACTGCCAATAGCCATGAGGAAGGCTACAGCCAATATCAGAACCTCAGGCTTAAAAAAGATGAA
CAACTGGAAATTGCACATGTGCTTGTCCAGTGTGTGGGTAGCGAGGCACAGTATAACGAGTACTATGCCTTGGTG
GCGAAGCAGGCGTGCGCAAAAAATAAAAGGATCAAATTCGCCTTCCAAGACCGAGTCTGGAAACTACTTCGCAGC
CTTGGAGAGCCATTATTTGGCGAAGAAATGGACGAGGACGAAAGACGAAACAATGAGGGGATGAAAGATGAGCGG
CGGATAAAGCACGTGGCCCGCTTCTATGCGTCCCTGGTAGGCAATGGCATACTAAGCATTCGCATTCTCAAGCCT
CTCGAGCTACACGAGGTGAATAAGGAGACGGCAACCTTTGTTGAATGCTTCCTCGTCAGCCTCCTTCGAGCCAGC
AAAAGAATTACCACTTCTTATAGCAGGATTACATTGGTTTATAAGAACTAG
Gene >OphauB2|5712
ATGCGCAATCAACTAGCAAAGGACGAGGCCGACATTGCCTACTATAAGAAAAAGCTTGGTATTAAGACGGGGCGC
AGGTGTTCGTCTACGGCCTTTAAAGAAGATGGCTTAGATACTCTGGTTGTCGAAGAAGAGGAAGACATCTGCCAC
AACTTACCAATAAAAAACAACAAGAAGCGCAAACAGGATTACGACGAATGGCTATCTGCGAAAAGGAGTAAAACG
TCAACCCACTGGAAATATTGGGATTCGGTTTATCGTAAAAGGAATCAAGGCGAAGCAGCTAATAGTTCACAATAT
GGCCAGGATTCGGAGACGCCAAAGTCGGTATTATATGGCGAAGAGAGAGCCTTATATGTGAAAGAAAACGATGAA
TTCTTTGCGGATTTTGATGCGTACGCTGAAGACAGAGACTCTCCACTACCTGAGGGTCGAGGAAATCCCTTTGCG
GTCCCTTTGATTGACGTGTCGACTGCTAGTCACGTCGTGTCGCATCGGAATGACGTTTCTGCGTCGCACCAGGGA
AACGAACTTAAGCTAAAGCGGCAGATTCAAGGCCAAATCAACCGTCTTACCGACAGCAATATTCTATCCATTGTT
CAAGTCGTCGACGCTATATACCAACAAAACCCGCGTGGCCATGTCACTGAGCTCTTGACAGACGCGGTTTTGGCA
CAAATCTGCAAGTCAGACAATATCCCTGACCAATTTTTTGTTCTTACAGGGGGCTTTTGCGCTGCAATATACAAG
GTTATTGGGCCTAGCTTTGGATCCCATCTATTGCGCAGGGTCGTCAAAGATTTCGCGACTCAATACCAAAGGGCG
AGTGAAACGAATCAGGCCCACATGCAGAAGGCGTCGTGCAATATCATGTCTTTACTTACACAGCTTTACACGTTT
GGAATTGTGAGCTGTAGGATCATTTTCGATTACATGCAACGGCTACTGCAGCAACTTTCTGAGATTAATGTCGAG
CTATTGTTGCGTGTCTGCCGAATGTCTGGCAGTCTTTTACGACGAGATGATAGGGAGAGATTCCGGCATATCTCA
GACGACCTAGCCAGAGCCATATCATATGCCAACAAATCCGACGCATCTAGCCGGACAAAGTTCATGATGGAGACA
ATTCAAAAACTCAGTACTGGCAAACAGAAGATCAAGCAGGTTGAATCTTTTGGCGTGTCAGAGCATATTGTTCGC
ATGAGAAAACACCTTGGCGAGCTCAAGTCTCAATCCAGAAGGCTTGACGGACTCGCGCCAATGGGTATTGGACTC
GGCGACATCGAAGGTGCTAAAGAGCATGGTAAATGGTGGCTTGCAGGAGCAAGTGTGCCAAACTCCCGTGGACAG
GTTGCCATGGCTAGAGACATGGTGGCAACAAGGCAAATTCGCGACAGTCTAAGCGGTGAAGATGAAGAAGACATG
AATTTGGTCCTGCCCGACTTCTACAACAAGGCACGAACCCAGGGGCTAACAACAAAGGCCCAAATTGCTATCTTT
ACGGCGCTCATGACTGCCAATAGCCATGAGGAAGGCTACAGCCAATATCAGAACCTCAGGCTTAAAAAAGATGAA
CAACTGGAAATTGCACATGTGCTTGTCCAGTGTGTGGGTAGCGAGGCACAGTATAACGAGTACTATGCCTTGGTG
GCGAAGCAGGCGTGCGCAAAAAATAAAAGGATCAAATTCGCCTTCCAAGACCGAGTCTGGAAACTACTTCGCAGC
CTTGGAGAGCCATTATTTGGCGAAGAAATGGACGAGGACGAAAGACGAAACAATGAGGGGATGAAAGATGAGCGG
CGGATAAAGCACGTGGCCCGCTTCTATGCGTCCCTGGTAGGCAATGGCATACTAAGCATTCGCATTCTCAAGCCT
CTCGAGCTACACGAGGTGAATAAGGAGACGGCAACCTTTGTTGAATGCTTCCTCGTCAGCCTCCTTCGAGTATGT
AGGGTCAAGGCCAAACACCAAGATAACGAGGGCACAGCGATAATTCTTTCTAATATTTTTAGGCCAGCAAAAGAA
TTACCACTTCTTATAGCAGGATTACATTGGTTTATAAGAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail