Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5696
Gene name
LocationContig_46:81527..84033
Strand-
Gene length (bp)2506
Transcript length (bp)2160
Coding sequence length (bp)2160
Protein length (aa) 720

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08785 Ku_PK_bind Ku C terminal domain like 1.5E-32 596 715
PF02735 Ku Ku70/Ku80 beta-barrel domain 1.3E-27 242 445
PF03731 Ku_N Ku70/Ku80 N-terminal alpha/beta domain 2.0E-09 6 139

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H6C5|KU80_CHAGB ATP-dependent DNA helicase II subunit 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KU80 PE=3 SV=1 1 712 0.0E+00
sp|Q7RX73|KU80_NEUCR ATP-dependent DNA helicase II subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-52 PE=3 SV=2 1 714 0.0E+00
sp|Q4WI96|KU80_ASPFU ATP-dependent DNA helicase II subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ku80 PE=3 SV=1 1 719 0.0E+00
sp|Q2MHH2|KU80_ASPOR ATP-dependent DNA helicase II subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ku80 PE=3 SV=1 1 713 0.0E+00
sp|Q2MHH1|KU80_ASPSO ATP-dependent DNA helicase II subunit 2 OS=Aspergillus sojae GN=ku80 PE=3 SV=1 1 713 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H6C5|KU80_CHAGB ATP-dependent DNA helicase II subunit 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KU80 PE=3 SV=1 1 712 0.0E+00
sp|Q7RX73|KU80_NEUCR ATP-dependent DNA helicase II subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-52 PE=3 SV=2 1 714 0.0E+00
sp|Q4WI96|KU80_ASPFU ATP-dependent DNA helicase II subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ku80 PE=3 SV=1 1 719 0.0E+00
sp|Q2MHH2|KU80_ASPOR ATP-dependent DNA helicase II subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ku80 PE=3 SV=1 1 713 0.0E+00
sp|Q2MHH1|KU80_ASPSO ATP-dependent DNA helicase II subunit 2 OS=Aspergillus sojae GN=ku80 PE=3 SV=1 1 713 0.0E+00
sp|Q5B4H8|KU80_EMENI ATP-dependent DNA helicase II subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ku80 PE=3 SV=1 1 717 0.0E+00
sp|Q1E6K9|KU80_COCIM ATP-dependent DNA helicase II subunit 2 OS=Coccidioides immitis (strain RS) GN=KU80 PE=3 SV=1 1 718 0.0E+00
sp|Q0U8L4|KU80_PHANO ATP-dependent DNA helicase II subunit 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KU80 PE=3 SV=1 31 716 0.0E+00
sp|Q6C7B9|KU80_YARLI ATP-dependent DNA helicase II subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KU80 PE=3 SV=1 1 681 6.0E-119
sp|Q9HGM8|KU80_SCHPO ATP-dependent DNA helicase II subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pku80 PE=1 SV=1 1 670 5.0E-82
sp|Q54LY5|XRCC5_DICDI X-ray repair cross-complementing protein 5 OS=Dictyostelium discoideum GN=ku80 PE=3 SV=1 4 714 3.0E-59
sp|Q75IP6|KU80_ORYSJ ATP-dependent DNA helicase 2 subunit KU80 OS=Oryza sativa subsp. japonica GN=KU80 PE=1 SV=1 4 714 3.0E-29
sp|Q9FQ09|KU80_ARATH ATP-dependent DNA helicase 2 subunit KU80 OS=Arabidopsis thaliana GN=KU80 PE=1 SV=1 4 714 4.0E-26
sp|P13010|XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens GN=XRCC5 PE=1 SV=3 315 714 2.0E-25
sp|P27641|XRCC5_MOUSE X-ray repair cross-complementing protein 5 OS=Mus musculus GN=Xrcc5 PE=1 SV=4 292 714 3.0E-23
sp|Q04437|KU80_YEAST ATP-dependent DNA helicase II subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKU80 PE=1 SV=1 5 497 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0006303 double-strand break repair via nonhomologous end joining Yes
GO:0003677 DNA binding Yes
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006950 response to stress No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006281 DNA repair No
GO:0006302 double-strand break repair No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0050896 response to stimulus No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5696
MAEKEATVFILDLGASMAEKRGGRDESDLDWSMRYVWDKITDIVAANRKTLCVGIVGLRTNETSNTLQEDDGYEN
ISVLQGLGPMSMTHLRSLQESIKPSKTWAGDAISAIVVAIDMIDAFTKKLKWIRKVVLITDGQAALDEEDIGDIS
AKMNSSNVQLTILGVDFDDAEYGFKEEDKSPIKAKNESTLRKLADSCEGAILATMAEAIGELDNPRIKSIKPFKT
YDGPLTLGNPETLPAAMNINVERYFKTHIARPLGATTVMVKSQQDAGTQSTHTVDADDMEGVELAPVKQDRTYSV
NNPNAPGGKKAVDFETLAKGYEYGRTAVPISESEQNITKLETYKSFSIVGFIPTEKYQTVLSMGETCVTYARKND
VKSELALSSLIWALMELETCAVARIVTKDGKEPLLVLLSPHIEPGFECLYDVPLPFAEDIRGYQFPPLDKVITVA
GQTLTTHRLLPTDELSQAMSDYVDAMDISTCDRDEEGNAVEWAPIDETYNPAVHRVNYAVKTRAVHPDKPITDIP
PVLLRFSSPPEALIAKAQSRIDTLVEMAQVKKVPPKAKGRQKREKAKPISGLDVDALLGVEKKRGIISPNNAVPD
FKQALAATESSDETSQAVKQMGTLVRSLITDSFGDSTYAQAIEYIGVMRQELTDAQEPGLYNAFARDLKRMLLSG
ALGGDRRDFWFRIRVSRLGLLDQTESEASETTRDEAEEYYTSRG*
Coding >OphauB2|5696
ATGGCGGAAAAAGAGGCCACCGTGTTTATCCTGGACCTTGGAGCGTCCATGGCGGAAAAGCGTGGCGGACGCGAC
GAATCGGACCTGGACTGGAGCATGCGCTATGTGTGGGACAAGATCACCGACATTGTTGCTGCAAACCGCAAAACG
CTGTGTGTGGGCATTGTCGGCCTGCGAACCAATGAGACCAGCAACACACTGCAAGAGGATGATGGCTACGAGAAC
ATCTCGGTGCTGCAGGGCCTAGGACCCATGTCTATGACGCATCTGCGCTCACTGCAAGAGTCTATCAAGCCCAGC
AAGACATGGGCGGGCGATGCCATATCAGCCATTGTTGTGGCCATTGACATGATTGACGCCTTTACCAAGAAGCTC
AAATGGATCCGCAAAGTCGTTCTCATTACTGACGGCCAAGCAGCGCTGGATGAGGAGGACATTGGCGACATCTCT
GCAAAGATGAACAGCTCCAATGTCCAGCTAACTATTCTGGGCGTGGACTTTGACGACGCAGAATATGGCTTCAAA
GAGGAAGACAAGTCGCCCATCAAGGCGAAAAATGAGTCGACGCTGAGAAAGCTGGCCGACTCGTGTGAGGGTGCC
ATCTTGGCCACCATGGCCGAAGCTATTGGCGAACTCGACAATCCACGCATCAAATCCATCAAACCATTCAAGACT
TACGACGGTCCTCTGACTCTGGGCAACCCCGAAACTTTGCCTGCGGCCATGAACATCAATGTCGAAAGGTACTTC
AAGACACACATTGCCCGGCCCCTAGGCGCGACGACTGTCATGGTGAAATCACAACAAGATGCGGGTACTCAGTCG
ACCCATACCGTAGATGCAGATGATATGGAGGGCGTCGAGCTGGCGCCCGTCAAACAAGACCGGACATACTCAGTC
AACAATCCCAATGCTCCTGGGGGCAAAAAAGCCGTCGACTTTGAGACACTGGCCAAAGGTTATGAATACGGAAGG
ACGGCCGTGCCCATAAGCGAATCTGAACAAAACATTACGAAATTAGAGACATACAAGTCTTTTTCGATTGTCGGC
TTCATTCCCACGGAAAAATATCAGACCGTTCTCAGTATGGGCGAGACTTGCGTCACATATGCTCGGAAGAATGAT
GTCAAGTCGGAGCTCGCCCTATCCTCCCTCATCTGGGCCCTCATGGAGCTCGAGACGTGTGCCGTTGCGCGCATA
GTCACCAAGGATGGCAAGGAGCCCTTGCTAGTCTTGCTGTCTCCTCACATTGAGCCTGGCTTTGAGTGCTTATAC
GACGTCCCCCTGCCTTTTGCAGAGGACATTCGTGGCTACCAGTTTCCGCCGCTGGACAAGGTGATTACGGTTGCT
GGGCAAACATTGACGACGCATCGGCTACTGCCCACAGATGAGTTGAGCCAGGCCATGAGCGACTATGTCGACGCA
ATGGATATATCCACATGCGACAGAGATGAAGAAGGGAATGCCGTCGAGTGGGCGCCAATTGATGAGACATACAAC
CCAGCTGTTCATCGCGTCAACTACGCCGTCAAGACGCGCGCCGTGCATCCTGACAAGCCCATTACTGATATCCCG
CCTGTACTCCTCCGATTCTCCTCTCCACCCGAGGCTTTGATTGCCAAGGCCCAGAGCAGAATAGACACATTGGTT
GAAATGGCACAAGTAAAAAAAGTGCCTCCCAAGGCAAAAGGCCGTCAAAAGAGGGAAAAGGCCAAGCCCATCTCT
GGCTTGGATGTGGATGCATTGCTGGGCGTCGAGAAGAAAAGGGGCATCATATCTCCAAACAACGCAGTGCCAGAC
TTCAAACAAGCGCTTGCAGCTACAGAATCATCAGACGAAACCAGCCAGGCAGTAAAGCAAATGGGTACACTGGTG
CGGTCGTTGATTACGGACAGCTTTGGCGACAGTACATACGCGCAGGCCATTGAATACATTGGGGTGATGCGTCAA
GAGCTCACGGATGCTCAAGAGCCTGGACTTTACAATGCATTTGCGCGAGACTTGAAGAGAATGCTGCTATCGGGC
GCGCTGGGAGGAGACAGACGAGACTTTTGGTTTCGGATTCGCGTGTCGAGGCTGGGACTGCTTGACCAGACTGAG
AGCGAAGCATCGGAGACGACGCGCGACGAAGCCGAAGAGTACTATACATCTAGAGGTTGA
Transcript >OphauB2|5696
ATGGCGGAAAAAGAGGCCACCGTGTTTATCCTGGACCTTGGAGCGTCCATGGCGGAAAAGCGTGGCGGACGCGAC
GAATCGGACCTGGACTGGAGCATGCGCTATGTGTGGGACAAGATCACCGACATTGTTGCTGCAAACCGCAAAACG
CTGTGTGTGGGCATTGTCGGCCTGCGAACCAATGAGACCAGCAACACACTGCAAGAGGATGATGGCTACGAGAAC
ATCTCGGTGCTGCAGGGCCTAGGACCCATGTCTATGACGCATCTGCGCTCACTGCAAGAGTCTATCAAGCCCAGC
AAGACATGGGCGGGCGATGCCATATCAGCCATTGTTGTGGCCATTGACATGATTGACGCCTTTACCAAGAAGCTC
AAATGGATCCGCAAAGTCGTTCTCATTACTGACGGCCAAGCAGCGCTGGATGAGGAGGACATTGGCGACATCTCT
GCAAAGATGAACAGCTCCAATGTCCAGCTAACTATTCTGGGCGTGGACTTTGACGACGCAGAATATGGCTTCAAA
GAGGAAGACAAGTCGCCCATCAAGGCGAAAAATGAGTCGACGCTGAGAAAGCTGGCCGACTCGTGTGAGGGTGCC
ATCTTGGCCACCATGGCCGAAGCTATTGGCGAACTCGACAATCCACGCATCAAATCCATCAAACCATTCAAGACT
TACGACGGTCCTCTGACTCTGGGCAACCCCGAAACTTTGCCTGCGGCCATGAACATCAATGTCGAAAGGTACTTC
AAGACACACATTGCCCGGCCCCTAGGCGCGACGACTGTCATGGTGAAATCACAACAAGATGCGGGTACTCAGTCG
ACCCATACCGTAGATGCAGATGATATGGAGGGCGTCGAGCTGGCGCCCGTCAAACAAGACCGGACATACTCAGTC
AACAATCCCAATGCTCCTGGGGGCAAAAAAGCCGTCGACTTTGAGACACTGGCCAAAGGTTATGAATACGGAAGG
ACGGCCGTGCCCATAAGCGAATCTGAACAAAACATTACGAAATTAGAGACATACAAGTCTTTTTCGATTGTCGGC
TTCATTCCCACGGAAAAATATCAGACCGTTCTCAGTATGGGCGAGACTTGCGTCACATATGCTCGGAAGAATGAT
GTCAAGTCGGAGCTCGCCCTATCCTCCCTCATCTGGGCCCTCATGGAGCTCGAGACGTGTGCCGTTGCGCGCATA
GTCACCAAGGATGGCAAGGAGCCCTTGCTAGTCTTGCTGTCTCCTCACATTGAGCCTGGCTTTGAGTGCTTATAC
GACGTCCCCCTGCCTTTTGCAGAGGACATTCGTGGCTACCAGTTTCCGCCGCTGGACAAGGTGATTACGGTTGCT
GGGCAAACATTGACGACGCATCGGCTACTGCCCACAGATGAGTTGAGCCAGGCCATGAGCGACTATGTCGACGCA
ATGGATATATCCACATGCGACAGAGATGAAGAAGGGAATGCCGTCGAGTGGGCGCCAATTGATGAGACATACAAC
CCAGCTGTTCATCGCGTCAACTACGCCGTCAAGACGCGCGCCGTGCATCCTGACAAGCCCATTACTGATATCCCG
CCTGTACTCCTCCGATTCTCCTCTCCACCCGAGGCTTTGATTGCCAAGGCCCAGAGCAGAATAGACACATTGGTT
GAAATGGCACAAGTAAAAAAAGTGCCTCCCAAGGCAAAAGGCCGTCAAAAGAGGGAAAAGGCCAAGCCCATCTCT
GGCTTGGATGTGGATGCATTGCTGGGCGTCGAGAAGAAAAGGGGCATCATATCTCCAAACAACGCAGTGCCAGAC
TTCAAACAAGCGCTTGCAGCTACAGAATCATCAGACGAAACCAGCCAGGCAGTAAAGCAAATGGGTACACTGGTG
CGGTCGTTGATTACGGACAGCTTTGGCGACAGTACATACGCGCAGGCCATTGAATACATTGGGGTGATGCGTCAA
GAGCTCACGGATGCTCAAGAGCCTGGACTTTACAATGCATTTGCGCGAGACTTGAAGAGAATGCTGCTATCGGGC
GCGCTGGGAGGAGACAGACGAGACTTTTGGTTTCGGATTCGCGTGTCGAGGCTGGGACTGCTTGACCAGACTGAG
AGCGAAGCATCGGAGACGACGCGCGACGAAGCCGAAGAGTACTATACATCTAGAGGTTGA
Gene >OphauB2|5696
ATGGCGGAAAAAGAGGCCACCGTGTTTATCCTGGACCTTGGAGCGTCCATGGCGGAAAAGCGTGGCGGACGCGAC
GAATCGGACCTGGACTGGAGCATGCGCTATGTGTGGGACAAGATCACCGACATTGTTGCTGCAAACCGCAAAACG
CTGTGTGTGGGCATTGTCGGCCTGCGAACCAATGAGACCAGCAACACACTGCAAGAGGATGATGGCTACGAGAAC
ATCTCGGTGCTGCAGGGCCTAGGACCCATGTCTATGACGCATCTGCGCTCACTGCAAGAGTCTATCAAGCCCAGC
AAGACATGGGCGGGCGATGCCATATCAGCCATTGTTGTGGCCATTGACATGATTGACGCCTTTACCAAGAAGCTC
AAATGGATCCGCAAAGTCGTTCTCATTACTGACGGCCAAGCAGCGCTGGATGAGGAGGACATTGGCGACATCTCT
GCAAAGATGAACAGCTCCAATGTCCAGCTAACTATTCTGTGAGCAACTGATTCAGCAAGTATTCAACTGAGCTCT
ACTAATGATCCAGGGGCGTGGACTTTGACGACGCAGAATATGGCTTCAAAGAGGAAGACAAGTCGCCCATCAAGG
TACCCTCTCCATGCTCTTCGCAATGGTCTGCAAGTCTCTTCATGACCCGGACTGATGCGTCTTCATTCTTTTCAG
GCGAAAAATGAGTCGACGCTGAGAAAGCTGGCCGACTCGTGTGAGGGTGCCATCTTGGCCACCATGGCCGAAGCT
ATTGGCGAACTCGACAATCCACGCATCAAATCCATCAAACCATTCAAGACTTACGACGGTCCTCTGACTCTGGGC
AACCCCGAAACTTTGCCTGCGGCCATGAACATCAATGTCGAAAGGTACTTCAAGACACACATTGCCCGGCCCCTA
GGCGCGACGACTGTCATGGTGAAATCACAACAAGATGCGGGTACTCAGTCGACCCATACCGTAGATGCAGATGAT
ATGGAGGGCGTCGAGCTGGCGCCCGTCAAACAAGACCGGACATACTCAGTCAACAATCCCAATGCTCCTGGGGGC
AAAAAAGCCGTCGACTTTGAGACACTGGCCAAAGGTTATGAATACGGAAGGACGGCCGTGCCCATAAGCGAATCT
GAACAAAACATTACGAAATTAGAGACATACAAGTCTTTTTCGATTGTCGGCTTCATTCCCACGGAAAAAGTCAGT
TCCTGTCCTTCATGTATACAAATTCCAATACTAACTGCACTTCAGTATCAGACCGTTCTCAGTATGGGCGAGACT
TGCGTCACATATGCTCGGAAGAATGATGTCAAGTCGGAGCTCGCCCTATCCTCCCTCATCTGGGCCCTCATGGAG
CTCGAGACGTGTGCCGTTGCGCGCATAGTCACCAAGGATGGCAAGGAGCCCTTGCTAGTCTTGCTGTCTCCTCAC
ATTGAGCCTGGCTTTGAGTGCTTATACGACGTCCCCCTGCCTTTTGCAGAGGACATTCGTGGCTACCAGTTTCCG
CCGCTGGACAAGGTGATTACGGTTGCTGGGCAAACATTGACGACGCATCGGCTACTGCCCACAGATGAGTTGAGC
CAGGCCATGAGCGACTATGTCGACGCAATGGATATATCCACATGCGACAGAGATGAAGAAGGGTATGACAAGAAT
TATGCTTGCAATGTGGTGCCATGCTCATCATTATCAGGAATGCCGTCGAGTGGGCGCCAATTGATGAGACATACA
ACCCAGCTGTTCATCGCGTCAACTACGCCGTCAAGACGCGCGCCGTGCATCCTGACAAGCCCATTACTGATATCC
CGCCTGTACTCCTCCGATTCTCCTCTCCACCCGAGGCTTTGATTGCCAAGGCCCAGAGCAGAATAGACACATTGG
TTGAAATGGCACAAGTAAAAAAAGGTAGGAGCAATGTGCGTTGCCGTTAGTGTTATGCAACTGACAGCAGGCACA
GTGCCTCCCAAGGCAAAAGGCCGTCAAAAGAGGGAAAAGGCCAAGCCCATCTCTGGCTTGGATGTGGATGCATTG
CTGGGCGTCGAGAAGAAAAGGGGCATCATATCTCCAAACAACGCAGTGCCAGACTTCAAACAAGCGCTTGCAGCT
ACAGAATCATCAGACGAAACCAGCCAGGCAGTAAAGCAAATGGGTACACTGGTGCGGTCGTTGATTACGGACAGC
TTTGGCGACAGTACATACGCGCAGGCCATTGAATACATTGGGGTGATGCGTCAAGAGCTCACGGATGCTCAAGAG
CCTGGACTTTACAATGCATTTGCGCGAGACTTGAAGAGAATGCTGCTATCGGGCGCGCTGGGAGGAGACAGACGA
GACTTTTGGTTTCGGATTCGCGTGTCGAGGCTGGGACTGCTTGACCAGACTGAGAGCGAAGCATCGGAGACGACG
CGCGACGAAGCCGAAGAGGTGAGTCTTGTCTTTTTGCTCCCATGTAGAGTCTAGAATGGACAAGAGGGCTAACAA
GATGCAACAGTACTATACATCTAGAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail