Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5694
Gene name
LocationContig_46:78588..79093
Strand+
Gene length (bp)505
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7T5|TIM14_GIBZE Mitochondrial import inner membrane translocase subunit TIM14 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAM18 PE=3 SV=1 1 104 4.0E-49
sp|Q7RX75|TIM14_NEUCR Mitochondrial import inner membrane translocase subunit tim14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim14 PE=3 SV=1 16 105 3.0E-47
sp|Q5B4H1|TIM14_EMENI Mitochondrial import inner membrane translocase subunit tim14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pam18 PE=3 SV=1 1 105 4.0E-47
sp|Q4WI88|TIM14_ASPFU Mitochondrial import inner membrane translocase subunit tim14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pam18 PE=3 SV=1 1 105 3.0E-46
sp|Q9UT37|TIM14_SCHPO Mitochondrial import inner membrane translocase subunit tim14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pam18 PE=3 SV=1 1 102 9.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7T5|TIM14_GIBZE Mitochondrial import inner membrane translocase subunit TIM14 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAM18 PE=3 SV=1 1 104 4.0E-49
sp|Q7RX75|TIM14_NEUCR Mitochondrial import inner membrane translocase subunit tim14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim14 PE=3 SV=1 16 105 3.0E-47
sp|Q5B4H1|TIM14_EMENI Mitochondrial import inner membrane translocase subunit tim14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pam18 PE=3 SV=1 1 105 4.0E-47
sp|Q4WI88|TIM14_ASPFU Mitochondrial import inner membrane translocase subunit tim14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pam18 PE=3 SV=1 1 105 3.0E-46
sp|Q9UT37|TIM14_SCHPO Mitochondrial import inner membrane translocase subunit tim14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pam18 PE=3 SV=1 1 102 9.0E-31
sp|Q6PBT7|TIM14_DANRE Mitochondrial import inner membrane translocase subunit TIM14 OS=Danio rerio GN=dnajc19 PE=3 SV=1 2 104 9.0E-29
sp|Q3ZBN8|TIM14_BOVIN Mitochondrial import inner membrane translocase subunit TIM14 OS=Bos taurus GN=DNAJC19 PE=3 SV=3 2 104 1.0E-27
sp|Q5RF34|TIM14_PONAB Mitochondrial import inner membrane translocase subunit TIM14 OS=Pongo abelii GN=DNAJC19 PE=3 SV=3 2 104 7.0E-27
sp|Q96DA6|TIM14_HUMAN Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens GN=DNAJC19 PE=1 SV=3 2 104 7.0E-27
sp|Q78YY6|DJC15_MOUSE DnaJ homolog subfamily C member 15 OS=Mus musculus GN=Dnajc15 PE=1 SV=1 4 102 1.0E-25
sp|Q9Y5T4|DJC15_HUMAN DnaJ homolog subfamily C member 15 OS=Homo sapiens GN=DNAJC15 PE=1 SV=2 3 102 7.0E-24
sp|Q5RCP4|DJC15_PONAB DnaJ homolog subfamily C member 15 OS=Pongo abelii GN=DNAJC15 PE=2 SV=1 3 102 2.0E-23
sp|Q9VTJ8|TIM14_DROME Mitochondrial import inner membrane translocase subunit TIM14 OS=Drosophila melanogaster GN=Tim14 PE=3 SV=2 39 103 3.0E-23
sp|Q759D2|TIM14_ASHGO Mitochondrial import inner membrane translocase subunit TIM14 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAM18 PE=3 SV=1 7 104 4.0E-23
sp|Q9CQV7|TIM14_MOUSE Mitochondrial import inner membrane translocase subunit TIM14 OS=Mus musculus GN=Dnajc19 PE=1 SV=3 2 104 2.0E-22
sp|Q6CEU0|TIM14_YARLI Mitochondrial import inner membrane translocase subunit TIM14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAM18 PE=3 SV=1 29 104 1.0E-21
sp|Q6DDA1|DJC15_XENTR DnaJ homolog subfamily C member 15 OS=Xenopus tropicalis GN=dnajc15 PE=2 SV=1 39 102 1.0E-21
sp|Q6CNW2|TIM14_KLULA Mitochondrial import inner membrane translocase subunit TIM14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAM18 PE=3 SV=1 2 105 2.0E-21
sp|Q6FPU1|TIM14_CANGA Mitochondrial import inner membrane translocase subunit TIM14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAM18 PE=3 SV=1 4 104 2.0E-21
sp|Q8RV04|TI141_ARATH Mitochondrial import inner membrane translocase subunit TIM14-1 OS=Arabidopsis thaliana GN=TIM14-1 PE=1 SV=1 1 101 2.0E-21
sp|Q07914|TIM14_YEAST Mitochondrial import inner membrane translocase subunit TIM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM18 PE=1 SV=1 38 104 3.0E-21
sp|Q59SI2|TIM14_CANAL Mitochondrial import inner membrane translocase subunit TIM14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAM18 PE=3 SV=1 9 104 6.0E-20
sp|Q9LYY2|TI143_ARATH Mitochondrial import inner membrane translocase subunit TIM14-3 OS=Arabidopsis thaliana GN=TIM14-3 PE=1 SV=1 19 101 7.0E-19
sp|Q617M0|TIM14_CAEBR Mitochondrial import inner membrane translocase subunit TIM14 OS=Caenorhabditis briggsae GN=dnj-21 PE=3 SV=1 32 102 2.0E-18
sp|Q6BH37|TIM14_DEBHA Mitochondrial import inner membrane translocase subunit TIM14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAM18 PE=3 SV=2 33 104 4.0E-18
sp|P91454|TIM14_CAEEL Mitochondrial import inner membrane translocase subunit TIM14 OS=Caenorhabditis elegans GN=dnj-21 PE=3 SV=1 32 102 4.0E-18
sp|P42834|MDJ2_YEAST Mitochondrial DnaJ homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDJ2 PE=1 SV=1 40 105 3.0E-17
sp|Q9SF33|TI142_ARATH Mitochondrial import inner membrane translocase subunit TIM14-2 OS=Arabidopsis thaliana GN=TIM14-2 PE=3 SV=1 39 101 6.0E-17
sp|Q54QN1|TIM14_DICDI Mitochondrial import inner membrane translocase subunit TIM14 OS=Dictyostelium discoideum GN=dnajc19 PE=3 SV=1 1 104 5.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 4 23 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5694
MSTILAVGGGVALAAFLGRAGLVAWRRSRGGAGALGQAFYKGGFESKMTKREATLILALNERTITKSSVSKAHRK
LMLLNHPDRNGSPYLAAKINEAKELLDKQVP*
Coding >OphauB2|5694
ATGTCCACTATTCTCGCAGTTGGCGGTGGCGTCGCCCTCGCCGCGTTCCTCGGTCGCGCCGGCCTTGTTGCATGG
CGCCGCTCCCGAGGCGGCGCTGGTGCCTTGGGCCAGGCTTTTTACAAGGGAGGCTTTGAAAGCAAAATGACCAAG
AGAGAGGCAACTCTAATACTCGCTCTAAATGAGCGTACTATCACAAAGAGCAGCGTCAGCAAGGCGCATCGCAAG
CTCATGCTACTCAACCACCCCGACCGCAACGGCAGTCCCTACCTTGCAGCCAAAATCAACGAAGCAAAGGAATTA
CTAGATAAACAAGTCCCATGA
Transcript >OphauB2|5694
ATGTCCACTATTCTCGCAGTTGGCGGTGGCGTCGCCCTCGCCGCGTTCCTCGGTCGCGCCGGCCTTGTTGCATGG
CGCCGCTCCCGAGGCGGCGCTGGTGCCTTGGGCCAGGCTTTTTACAAGGGAGGCTTTGAAAGCAAAATGACCAAG
AGAGAGGCAACTCTAATACTCGCTCTAAATGAGCGTACTATCACAAAGAGCAGCGTCAGCAAGGCGCATCGCAAG
CTCATGCTACTCAACCACCCCGACCGCAACGGCAGTCCCTACCTTGCAGCCAAAATCAACGAAGCAAAGGAATTA
CTAGATAAACAAGTCCCATGA
Gene >OphauB2|5694
ATGTCCACTATTCTCGCAGTTGGCGGTGGCGTCGCCCTCGCCGCGTTCCTCGTCAGTCTCGACCTGCCTCCCGAT
CCCTCTCTCCCCACCTCGGAGCTAATACAGCACAACAGGGTCGCGCCGGCCTTGTTGCATGGCGCCGCTCCCGAG
GCGGCGCTGGTGCCTTGGGCCAGGCTTTTTACAAGGGAGGCTTTGAAAGCAAAATGACCAAGAGAGAGGCAACTC
TAATACTCGCTCTAAAGTACGTCTTTCCCGGGGGCTCCGCTGCGTTTTGTCTTGGCTGCCCCTTTCCAGGGCCTT
TTGCCACAAAATCATGGCTCTCTCTTCTGCTTGTCTCTCCTCGGGTTTCCTAATATGTCGCAGTGAGCGTACTAT
CACAAAGAGCAGCGTCAGCAAGGCGCATCGCAAGCTCATGCTACTCAACCACCCCGACCGCAACGGCAGTCCCTA
CCTTGCAGCCAAAATCAACGAAGCAAAGGAATTACTAGATAAACAAGTCCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail