Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5687
Gene name
LocationContig_46:54510..56843
Strand-
Gene length (bp)2333
Transcript length (bp)2265
Coding sequence length (bp)2265
Protein length (aa) 755

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02847 MA3 MA3 domain 1.6E-23 397 502
PF02854 MIF4G MIF4G domain 3.9E-10 114 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BGP1|CWC22_EMENI Pre-mRNA-splicing factor cwc22 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc22 PE=3 SV=2 33 599 0.0E+00
sp|Q8C5N3|CWC22_MOUSE Pre-mRNA-splicing factor CWC22 homolog OS=Mus musculus GN=Cwc22 PE=1 SV=1 47 594 0.0E+00
sp|Q5ZKA3|CWC22_CHICK Pre-mRNA-splicing factor CWC22 homolog OS=Gallus gallus GN=CWC22 PE=2 SV=2 26 594 0.0E+00
sp|Q08C72|CWC22_DANRE Pre-mRNA-splicing factor CWC22 homolog OS=Danio rerio GN=cwc22 PE=2 SV=1 39 594 0.0E+00
sp|Q9HCG8|CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens GN=CWC22 PE=1 SV=3 37 594 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BGP1|CWC22_EMENI Pre-mRNA-splicing factor cwc22 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc22 PE=3 SV=2 33 599 0.0E+00
sp|Q8C5N3|CWC22_MOUSE Pre-mRNA-splicing factor CWC22 homolog OS=Mus musculus GN=Cwc22 PE=1 SV=1 47 594 0.0E+00
sp|Q5ZKA3|CWC22_CHICK Pre-mRNA-splicing factor CWC22 homolog OS=Gallus gallus GN=CWC22 PE=2 SV=2 26 594 0.0E+00
sp|Q08C72|CWC22_DANRE Pre-mRNA-splicing factor CWC22 homolog OS=Danio rerio GN=cwc22 PE=2 SV=1 39 594 0.0E+00
sp|Q9HCG8|CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens GN=CWC22 PE=1 SV=3 37 594 0.0E+00
sp|Q5RA93|CWC22_PONAB Pre-mRNA-splicing factor CWC22 homolog OS=Pongo abelii GN=CWC22 PE=2 SV=1 37 594 0.0E+00
sp|Q9VJ87|CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster GN=ncm PE=1 SV=3 11 603 0.0E+00
sp|Q52KN9|CWC22_XENLA Pre-mRNA-splicing factor CWC22 homolog OS=Xenopus laevis GN=cwc22 PE=2 SV=1 49 594 0.0E+00
sp|Q9P6R9|CWC22_SCHPO Pre-mRNA-splicing factor cwf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf22 PE=1 SV=3 50 620 0.0E+00
sp|P0CM96|CWC22_CRYNJ Pre-mRNA-splicing factor CWC22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC22 PE=3 SV=1 59 594 0.0E+00
sp|P0CM97|CWC22_CRYNB Pre-mRNA-splicing factor CWC22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC22 PE=3 SV=1 59 594 0.0E+00
sp|Q52B63|CWC22_MAGO7 Pre-mRNA-splicing factor CWC22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC22 PE=3 SV=1 41 592 0.0E+00
sp|Q7RX84|CWC22_NEUCR Pre-mRNA-splicing factor cwc22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-1 PE=3 SV=1 44 592 0.0E+00
sp|Q4WKB9|CWC22_ASPFU Pre-mRNA-splicing factor cwc22 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc22 PE=3 SV=1 18 606 0.0E+00
sp|Q4PCY0|CWC22_USTMA Pre-mRNA-splicing factor CWC22 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC22 PE=3 SV=2 73 594 0.0E+00
sp|Q17336|CWC22_CAEEL Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis elegans GN=let-858 PE=2 SV=1 68 588 4.0E-176
sp|A8WT19|CWC22_CAEBR Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis briggsae GN=let-858 PE=3 SV=2 50 591 2.0E-169
sp|Q6BU84|CWC22_DEBHA Pre-mRNA-splicing factor CWC22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC22 PE=3 SV=2 69 593 1.0E-166
sp|Q6C8C5|CWC22_YARLI Pre-mRNA-splicing factor CWC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC22 PE=3 SV=1 46 589 3.0E-165
sp|Q59XY0|CWC22_CANAL Pre-mRNA-splicing factor CWC22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC22 PE=3 SV=1 104 595 4.0E-106
sp|Q751P4|CWC22_ASHGO Pre-mRNA-splicing factor CWC22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CWC22 PE=3 SV=1 102 679 6.0E-70
sp|P53333|CWC22_YEAST Pre-mRNA-splicing factor CWC22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC22 PE=1 SV=1 94 686 2.0E-62
sp|Q3UFM5|NOM1_MOUSE Nucleolar MIF4G domain-containing protein 1 OS=Mus musculus GN=Nom1 PE=1 SV=2 76 547 4.0E-19
sp|Q5C9Z4|NOM1_HUMAN Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens GN=NOM1 PE=1 SV=1 79 514 3.0E-18
sp|O13971|SGD1_SCHPO Suppressor of glycerol defect protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgd1 PE=3 SV=1 76 533 2.0E-17
sp|Q06132|SGD1_YEAST Suppressor of glycerol defect protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGD1 PE=1 SV=1 82 476 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5687
MASVEMDIPRRERRPPFEGGDSYRPSRRSRSRERGRERYRERERPARRERVRTPPPPRTEEEKQATAKAEYEKLL
NVRSGGTYIPPARLRALQAQITDKKSKEYQRMAWEALKKSINGLINKVNTANIKHIVPELFGENLVRGRGLFCRS
IMKAQAASLPFTPIYAAMAAIVNTKLPQVGELLVKRLVMQFRKSFRRNDKAVCLSSTTFLAHLINHQVQHEILAG
QILLLLLQKPTDDSVEIAVGFCREVGQYVEEMQPSIAMAVFDQFRSILHEADIDKRTQYMIEVLFQVRKDKYKDN
PAIKEELDLVEEEDQVTHQIVLEGEIDVQDGLNVFKYDGEWEENEEAYRKLKAEILGDDDDDDDDDDGEDEEVSE
EEDEETKAMEIKDQTNVDLVNLRRTIYLTIMSSADPEEAVHKLMKINLPAGQEPELPSMIVECCSQEKTYTKFFG
LIGERFAKINRLWCDLFEQAFAKYYDTIHRYDNNKLRNIAMLFGHMFASDALGWHCLSVIHLNEDETTSSSRIFI
KILFQSIVEETGMAKVRERMNDEALRADFAGIFPRDNARNIRFSINYFTSIGMGALTEEMREYLQQMPKPALPAP
AAQHDESDSDSVSSYSSYTGSSLSPTPARSRSRQPTSRRQYSRSVSRSPSSPSPSPRRDGRSPPLRSRRRYSQSP
SPSPAPRGRRRYSETQKEKQCRVFEIAFSSAHEEQSAAQEVSFSCTREEQSAAGKIACSNTHKKQSATREIALAA
SQKS*
Coding >OphauB2|5687
ATGGCATCTGTCGAAATGGACATTCCACGGCGCGAGCGCAGACCCCCCTTTGAGGGCGGCGACTCGTACCGCCCA
TCACGACGGTCGCGATCACGAGAGCGAGGCCGCGAGCGCTACAGGGAGCGAGAAAGACCAGCAAGGCGTGAGCGG
GTACGCACGCCTCCTCCGCCGCGCACCGAGGAGGAGAAACAGGCCACGGCAAAGGCAGAGTACGAAAAGCTGCTC
AACGTGCGCTCTGGAGGCACCTATATCCCGCCCGCACGTCTTCGAGCCCTGCAGGCGCAAATCACGGATAAGAAG
AGCAAGGAGTATCAGCGAATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGCCTCATCAACAAGGTCAACACG
GCAAACATTAAGCACATTGTTCCCGAGCTGTTTGGCGAAAACTTGGTTCGCGGCCGAGGTTTGTTTTGCCGCTCC
ATCATGAAGGCTCAGGCGGCTAGCTTGCCCTTTACGCCCATTTACGCAGCCATGGCGGCCATTGTCAATACAAAA
CTGCCTCAGGTTGGCGAACTGCTTGTCAAGCGACTCGTCATGCAGTTTCGAAAGAGCTTCAGGCGCAACGACAAG
GCCGTTTGCCTATCGTCGACTACGTTTCTCGCCCACCTCATCAACCACCAGGTGCAGCATGAGATACTGGCGGGA
CAGATTCTGCTCCTCTTGTTGCAGAAGCCGACGGATGACAGCGTCGAGATTGCCGTGGGCTTTTGTCGTGAAGTT
GGCCAATACGTTGAGGAGATGCAGCCGTCCATCGCCATGGCTGTCTTTGACCAGTTTCGCAGCATCTTGCACGAG
GCGGATATCGACAAGCGCACGCAGTACATGATTGAGGTGCTCTTCCAGGTCCGCAAGGACAAGTACAAGGACAAT
CCAGCAATCAAGGAGGAGCTGGACCTGGTGGAAGAGGAGGACCAGGTGACGCACCAAATTGTCCTCGAGGGCGAA
ATCGATGTCCAGGATGGACTCAATGTCTTCAAATACGATGGAGAATGGGAAGAGAATGAAGAGGCGTATAGGAAG
CTCAAGGCGGAGATTTTGGGCGATGACGACGACGATGACGACGATGACGACGGCGAGGATGAGGAGGTTTCCGAG
GAGGAAGACGAAGAGACCAAGGCCATGGAGATTAAAGATCAGACCAACGTGGACCTGGTTAATTTGCGCAGGACC
ATTTATCTAACCATTATGTCCAGCGCCGACCCCGAAGAAGCAGTGCACAAGTTGATGAAGATTAATCTTCCCGCA
GGCCAGGAGCCAGAGCTGCCGTCCATGATTGTCGAGTGCTGCTCGCAGGAAAAGACGTATACCAAGTTTTTTGGT
CTCATTGGCGAGCGCTTTGCCAAGATTAACCGTCTTTGGTGCGATCTCTTTGAGCAGGCATTTGCAAAGTACTAC
GACACTATTCACCGCTACGACAACAACAAGCTGCGCAACATTGCCATGTTGTTTGGCCACATGTTTGCCTCGGAC
GCCCTGGGATGGCACTGTCTATCCGTCATCCACCTCAACGAGGACGAGACGACGTCGAGCAGCCGCATCTTTATC
AAGATTCTCTTTCAGAGCATTGTCGAGGAGACGGGCATGGCCAAGGTGCGGGAGCGCATGAATGACGAAGCGCTA
CGGGCCGACTTTGCCGGCATTTTCCCCAGAGACAATGCGCGCAACATTCGCTTCTCCATCAACTACTTTACCAGC
ATTGGCATGGGCGCCCTGACGGAGGAGATGCGCGAGTATTTGCAACAGATGCCCAAGCCAGCGCTTCCAGCACCA
GCGGCGCAGCATGACGAGTCCGACTCGGACTCGGTGTCGAGCTATTCCTCGTACACGGGCTCGTCCCTGTCGCCG
ACGCCCGCCCGGTCACGGAGCCGGCAGCCGACGAGTCGGCGCCAGTACAGTCGGAGCGTGTCTCGGTCGCCGTCG
TCGCCATCACCGTCGCCTAGACGAGATGGCCGGTCGCCGCCCTTGAGGAGCAGGAGGCGGTACAGTCAGAGTCCA
TCACCGTCGCCGGCGCCCAGGGGGAGGAGGCGGTACAGCGAGACGCAGAAGGAGAAGCAGTGCAGGGTCTTTGAG
ATCGCCTTCTCCAGTGCGCATGAGGAACAGTCGGCTGCCCAAGAGGTCAGCTTCTCCTGCACGCGCGAGGAACAG
TCGGCTGCCGGAAAGATCGCCTGCTCCAACACGCACAAGAAACAGTCGGCTACCCGAGAGATCGCTCTCGCGGCC
TCGCAGAAGAGCTAG
Transcript >OphauB2|5687
ATGGCATCTGTCGAAATGGACATTCCACGGCGCGAGCGCAGACCCCCCTTTGAGGGCGGCGACTCGTACCGCCCA
TCACGACGGTCGCGATCACGAGAGCGAGGCCGCGAGCGCTACAGGGAGCGAGAAAGACCAGCAAGGCGTGAGCGG
GTACGCACGCCTCCTCCGCCGCGCACCGAGGAGGAGAAACAGGCCACGGCAAAGGCAGAGTACGAAAAGCTGCTC
AACGTGCGCTCTGGAGGCACCTATATCCCGCCCGCACGTCTTCGAGCCCTGCAGGCGCAAATCACGGATAAGAAG
AGCAAGGAGTATCAGCGAATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGCCTCATCAACAAGGTCAACACG
GCAAACATTAAGCACATTGTTCCCGAGCTGTTTGGCGAAAACTTGGTTCGCGGCCGAGGTTTGTTTTGCCGCTCC
ATCATGAAGGCTCAGGCGGCTAGCTTGCCCTTTACGCCCATTTACGCAGCCATGGCGGCCATTGTCAATACAAAA
CTGCCTCAGGTTGGCGAACTGCTTGTCAAGCGACTCGTCATGCAGTTTCGAAAGAGCTTCAGGCGCAACGACAAG
GCCGTTTGCCTATCGTCGACTACGTTTCTCGCCCACCTCATCAACCACCAGGTGCAGCATGAGATACTGGCGGGA
CAGATTCTGCTCCTCTTGTTGCAGAAGCCGACGGATGACAGCGTCGAGATTGCCGTGGGCTTTTGTCGTGAAGTT
GGCCAATACGTTGAGGAGATGCAGCCGTCCATCGCCATGGCTGTCTTTGACCAGTTTCGCAGCATCTTGCACGAG
GCGGATATCGACAAGCGCACGCAGTACATGATTGAGGTGCTCTTCCAGGTCCGCAAGGACAAGTACAAGGACAAT
CCAGCAATCAAGGAGGAGCTGGACCTGGTGGAAGAGGAGGACCAGGTGACGCACCAAATTGTCCTCGAGGGCGAA
ATCGATGTCCAGGATGGACTCAATGTCTTCAAATACGATGGAGAATGGGAAGAGAATGAAGAGGCGTATAGGAAG
CTCAAGGCGGAGATTTTGGGCGATGACGACGACGATGACGACGATGACGACGGCGAGGATGAGGAGGTTTCCGAG
GAGGAAGACGAAGAGACCAAGGCCATGGAGATTAAAGATCAGACCAACGTGGACCTGGTTAATTTGCGCAGGACC
ATTTATCTAACCATTATGTCCAGCGCCGACCCCGAAGAAGCAGTGCACAAGTTGATGAAGATTAATCTTCCCGCA
GGCCAGGAGCCAGAGCTGCCGTCCATGATTGTCGAGTGCTGCTCGCAGGAAAAGACGTATACCAAGTTTTTTGGT
CTCATTGGCGAGCGCTTTGCCAAGATTAACCGTCTTTGGTGCGATCTCTTTGAGCAGGCATTTGCAAAGTACTAC
GACACTATTCACCGCTACGACAACAACAAGCTGCGCAACATTGCCATGTTGTTTGGCCACATGTTTGCCTCGGAC
GCCCTGGGATGGCACTGTCTATCCGTCATCCACCTCAACGAGGACGAGACGACGTCGAGCAGCCGCATCTTTATC
AAGATTCTCTTTCAGAGCATTGTCGAGGAGACGGGCATGGCCAAGGTGCGGGAGCGCATGAATGACGAAGCGCTA
CGGGCCGACTTTGCCGGCATTTTCCCCAGAGACAATGCGCGCAACATTCGCTTCTCCATCAACTACTTTACCAGC
ATTGGCATGGGCGCCCTGACGGAGGAGATGCGCGAGTATTTGCAACAGATGCCCAAGCCAGCGCTTCCAGCACCA
GCGGCGCAGCATGACGAGTCCGACTCGGACTCGGTGTCGAGCTATTCCTCGTACACGGGCTCGTCCCTGTCGCCG
ACGCCCGCCCGGTCACGGAGCCGGCAGCCGACGAGTCGGCGCCAGTACAGTCGGAGCGTGTCTCGGTCGCCGTCG
TCGCCATCACCGTCGCCTAGACGAGATGGCCGGTCGCCGCCCTTGAGGAGCAGGAGGCGGTACAGTCAGAGTCCA
TCACCGTCGCCGGCGCCCAGGGGGAGGAGGCGGTACAGCGAGACGCAGAAGGAGAAGCAGTGCAGGGTCTTTGAG
ATCGCCTTCTCCAGTGCGCATGAGGAACAGTCGGCTGCCCAAGAGGTCAGCTTCTCCTGCACGCGCGAGGAACAG
TCGGCTGCCGGAAAGATCGCCTGCTCCAACACGCACAAGAAACAGTCGGCTACCCGAGAGATCGCTCTCGCGGCC
TCGCAGAAGAGCTAG
Gene >OphauB2|5687
ATGGCATCTGTCGAAATGGACATTCCACGGCGCGAGCGCAGACCCCCCTTTGAGGGCGGCGACTCGTACCGCCCA
TCACGACGGTCGCGATCACGAGAGCGAGGCCGCGAGCGCTACAGGGAGCGAGAAAGACCAGCAAGGCGTGAGCGG
GTACGCACGCCTCCTCCGCCGCGCACCGAGGAGGAGAAACAGGCCACGGCAAAGGCAGAGTACGAAAAGCTGCTC
AACGTGCGCTCTGGAGGCACCTATATCCCGCCCGCACGTCTTCGAGCCCTGCAGGCGCAAATCACGGATAAGAAG
AGCAAGGAGTATCAGCGAATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGCCTCATCAACAAGGTCAACACG
GCAAACATTAAGCACATTGTTCCCGAGCTGTTTGGCGAAAACTTGGTTCGCGGCCGAGGTTTGTTTTGCCGCTCC
ATCATGAAGGCTCAGGCGGCTAGCTTGCCCTTTACGCCCATTTACGCAGCCATGGCGGCCATTGTCAATACAAAA
CTGCCTCAGGTTGGCGAACTGCTTGTCAAGCGACTCGTCATGCAGTTTCGAAAGAGCTTCAGGCGCAACGACAAG
GCCGTTTGCCTATCGTCGACTACGTTTCTCGCCCACCTCATCAACCACCAGGTGCAGCATGAGATACTGGCGGGA
CAGATTCTGCTCCTCTTGTTGCAGAAGCCGACGGATGACAGCGTCGAGATTGCCGTGGGCTTTTGTCGTGAAGTT
GGCCAATACGTTGAGGAGATGCAGCCGTCCATCGCCATGGCTGTCTTTGACCAGTTTCGCAGCATCTTGCACGAG
GCGGATATCGACAAGCGCACGCAGTACATGATTGAGGTGCTCTTCCAGGTCCGCAAGGACAAGTACAAGGACAAT
CCAGCAATCAAGGAGGAGCTGGACCTGGTGGAAGAGGAGGACCAGGTGACGCACCAAATTGTCCTCGAGGGCGAA
ATCGATGTCCAGGATGGACTCAATGTCTTCAAATACGATGGAGAATGGGAAGAGAATGAAGAGGCGTATAGGAAG
CTCAAGGCGGAGATTTTGGGCGATGACGACGACGATGACGACGATGACGACGGCGAGGATGAGGAGGTTTCCGAG
GAGGAAGACGAAGAGACCAAGGCCATGGAGATTAAAGATCAGACCAACGTGGACCTGGTTAATTTGCGCAGGACC
ATTTATCTAACCATTATGTCCAGCGCCGACCCCGAAGAAGCAGTGCACAAGTTGATGAAGATTAATCTTCCCGCA
GGCCAGGAGCCAGAGCTGCCGTCCATGATTGTCGAGTGCTGCTCGCAGGAAAAGACGTATACCAAGTTTTTTGGT
CTCATTGGCGAGCGCTTTGCCAAGATTAACCGTCTTTGGTGCGATCTCTTTGAGCAGGCATTTGCAAAGTACTAC
GACACTATTCACCGCTACGACAACAACAAGCTGCGCAACATTGCCATGTTGTTTGGCCACATGTTTGCCTCGGAC
GCCCTGGGATGGCACTGTCTATCCGTCATCCACCTCAACGAGGACGAGACGACGTCGAGCAGCCGCATCTTTATC
AAGATTCTCTTTCAGAGCATTGTCGAGGAGACGGGCATGGCCAAGGTGCGGGAGCGCATGAATGACGAAGCGCTA
CGGGCCGACTTTGCCGGCATTTTCCCCAGAGACAATGCGCGCAACATTCGCTTCTCCATCAACTACTTTACCAGC
ATTGGCATGGGCGCCCTGACGGAGGAGATGCGCGAGTATTTGCAACAGATGCCCAAGCCAGCGCTTCCAGCACCA
GCGGCGCAGCATGACGAGTCCGACTCGGACTCGGTGTCGAGCTATTCCTCGTACACGGGCTCGTCCCTGTCGCCG
ACGCCCGCCCGGTCACGGAGCCGGCAGCCGACGAGTCGGCGCCAGTACAGTCGGAGCGTGTCTCGGTCGCCGTCG
TCGCCATCACCGTCGCCTAGACGAGATGGCCGGTCGCCGCCCTTGAGGAGCAGGAGGCGGTACAGTCAGAGTCCA
TCACCGTCGCCGGCGCCCAGGGGGAGGAGGCGGTACAGCGAGAGTCGGTCGCCGTCGCCATCGCTTTCGCCTTCT
CCGGTCCGAGGGCGGTCGAGGTCGCCGCTGCCCCAGCGCAGAAGGAGAAGCAGTGCAGGGTCTTTGAGATCGCCT
TCTCCAGTGCGCATGAGGAACAGTCGGCTGCCCAAGAGGTCAGCTTCTCCTGCACGCGCGAGGAACAGTCGGCTG
CCGGAAAGATCGCCTGCTCCAACACGCACAAGAAACAGTCGGCTACCCGAGAGATCGCTCTCGCGGCCTCGCAGA
AGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail