Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5681
Gene name
LocationContig_46:39678..40267
Strand+
Gene length (bp)589
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00410 Ribosomal_S8 Ribosomal protein S8 3.0E-21 7 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RV75|RS22_NEUCR 40S ribosomal protein S22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-27 PE=3 SV=1 1 130 3.0E-88
sp|Q6FMW9|RS22_CANGA 40S ribosomal protein S22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS22 PE=3 SV=3 1 130 9.0E-79
sp|P33953|RS22_KLUMA 40S ribosomal protein S22 OS=Kluyveromyces marxianus GN=RPS22 PE=3 SV=3 1 130 1.0E-78
sp|P0C0W1|RS22A_YEAST 40S ribosomal protein S22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22A PE=1 SV=2 1 130 2.0E-78
sp|Q6CW21|RS22_KLULA 40S ribosomal protein S22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS22 PE=1 SV=3 1 130 3.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RV75|RS22_NEUCR 40S ribosomal protein S22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-27 PE=3 SV=1 1 130 3.0E-88
sp|Q6FMW9|RS22_CANGA 40S ribosomal protein S22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS22 PE=3 SV=3 1 130 9.0E-79
sp|P33953|RS22_KLUMA 40S ribosomal protein S22 OS=Kluyveromyces marxianus GN=RPS22 PE=3 SV=3 1 130 1.0E-78
sp|P0C0W1|RS22A_YEAST 40S ribosomal protein S22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22A PE=1 SV=2 1 130 2.0E-78
sp|Q6CW21|RS22_KLULA 40S ribosomal protein S22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS22 PE=1 SV=3 1 130 3.0E-78
sp|Q3E7Y3|RS22B_YEAST 40S ribosomal protein S22-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22B PE=1 SV=3 1 130 5.0E-78
sp|Q752J5|RS22_ASHGO 40S ribosomal protein S22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS22A PE=3 SV=3 1 130 1.0E-77
sp|Q96W54|RS22_CANAL 40S ribosomal protein S22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS22A PE=3 SV=3 1 130 2.0E-76
sp|Q9AT34|RS15A_DAUCA 40S ribosomal protein S15a OS=Daucus carota GN=RPS15A PE=2 SV=3 1 130 2.0E-71
sp|P42798|R15A1_ARATH 40S ribosomal protein S15a-1 OS=Arabidopsis thaliana GN=RPS15AA PE=2 SV=2 1 130 5.0E-71
sp|Q00332|RS15A_BRANA 40S ribosomal protein S15a OS=Brassica napus GN=RPS15A PE=2 SV=3 1 130 6.0E-71
sp|O80646|R15A3_ARATH 40S ribosomal protein S15a-3 OS=Arabidopsis thaliana GN=RPS15AC PE=2 SV=2 1 130 1.0E-70
sp|Q9LX88|R15A4_ARATH 40S ribosomal protein S15a-4 OS=Arabidopsis thaliana GN=RPS15AD PE=2 SV=3 1 130 8.0E-70
sp|P62246|RS15A_RAT 40S ribosomal protein S15a OS=Rattus norvegicus GN=Rps15a PE=1 SV=2 1 130 1.0E-69
sp|P62245|RS15A_MOUSE 40S ribosomal protein S15a OS=Mus musculus GN=Rps15a PE=1 SV=2 1 130 1.0E-69
sp|P62244|RS15A_HUMAN 40S ribosomal protein S15a OS=Homo sapiens GN=RPS15A PE=1 SV=2 1 130 1.0E-69
sp|Q76I82|RS15A_BOVIN 40S ribosomal protein S15a OS=Bos taurus GN=RPS15A PE=2 SV=1 1 130 1.0E-69
sp|Q5R938|RS15A_PONAB 40S ribosomal protein S15a OS=Pongo abelii GN=RPS15A PE=2 SV=1 1 130 6.0E-69
sp|Q6XIM8|RS15A_DROYA 40S ribosomal protein S15a OS=Drosophila yakuba GN=RpS15Aa PE=2 SV=3 1 130 6.0E-69
sp|P48149|RS15A_DROME 40S ribosomal protein S15Aa OS=Drosophila melanogaster GN=RpS15Aa PE=1 SV=2 1 130 6.0E-69
sp|P33095|RS15A_STRPU 40S ribosomal protein S15a OS=Strongylocentrotus purpuratus GN=RPS15A PE=2 SV=3 1 130 1.0E-68
sp|Q7KR04|RS15B_DROME 40S ribosomal protein S15Ab OS=Drosophila melanogaster GN=RpS15Ab PE=2 SV=3 1 130 3.0E-67
sp|Q90YQ8|RS15A_ICTPU 40S ribosomal protein S15a OS=Ictalurus punctatus GN=rps15a PE=2 SV=3 1 130 3.0E-67
sp|P50891|RS15A_PARLI 40S ribosomal protein S15a OS=Paracentrotus lividus GN=RPS15A PE=2 SV=2 1 130 6.0E-66
sp|P0CT59|RS22B_SCHPO 40S ribosomal protein S22-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2202 PE=3 SV=1 1 130 8.0E-66
sp|P0CT58|RS22A_SCHPO 40S ribosomal protein S22-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2201 PE=2 SV=1 1 130 8.0E-66
sp|P46792|RS22_AGABI 40S ribosomal protein S22 OS=Agaricus bisporus GN=rps22 PE=2 SV=1 1 130 1.0E-63
sp|P46793|RS15A_DICDI 40S ribosomal protein S15a OS=Dictyostelium discoideum GN=rps15a PE=2 SV=3 1 130 2.0E-63
sp|A8MAJ5|RS8_CALMQ 30S ribosomal protein S8 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps8 PE=3 SV=1 1 130 3.0E-43
sp|Q8U014|RS8_PYRFU 30S ribosomal protein S8 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps8 PE=1 SV=1 1 130 3.0E-41
sp|O59432|RS8_PYRHO 30S ribosomal protein S8 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps8 PE=3 SV=1 1 130 9.0E-41
sp|B8GKE8|RS8_METPE 30S ribosomal protein S8 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps8 PE=3 SV=1 1 130 4.0E-40
sp|A0B9V5|RS8_METTP 30S ribosomal protein S8 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps8 PE=3 SV=1 7 130 7.0E-40
sp|Q9V1V0|RS8_PYRAB 30S ribosomal protein S8 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps8 PE=3 SV=1 1 130 1.0E-39
sp|A2SPL7|RS8_METLZ 30S ribosomal protein S8 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps8 PE=3 SV=1 1 130 6.0E-39
sp|A3DNC2|RS8_STAMF 30S ribosomal protein S8 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps8 PE=3 SV=1 1 130 8.0E-39
sp|A3MSJ6|RS8_PYRCJ 30S ribosomal protein S8 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps8 PE=3 SV=1 1 130 9.0E-39
sp|Q0W1X3|RS8_METAR 30S ribosomal protein S8 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps8 PE=3 SV=1 1 130 9.0E-39
sp|C6A175|RS8_THESM 30S ribosomal protein S8 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps8 PE=3 SV=1 1 130 2.0E-38
sp|B1Y8V5|RS8_PYRNV 30S ribosomal protein S8 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps8 PE=3 SV=1 1 130 2.0E-38
sp|Q46GB0|RS8_METBF 30S ribosomal protein S8 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps8 PE=3 SV=1 1 130 5.0E-38
sp|A3CT12|RS8_METMJ 30S ribosomal protein S8 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps8 PE=3 SV=1 1 130 6.0E-38
sp|Q9M0E0|R15A5_ARATH 40S ribosomal protein S15a-5 OS=Arabidopsis thaliana GN=RPS15AE PE=2 SV=1 6 130 6.0E-38
sp|Q8PV35|RS8_METMA 30S ribosomal protein S8 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps8 PE=3 SV=1 1 130 1.0E-37
sp|C5A270|RS8_THEGJ 30S ribosomal protein S8 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps8 PE=3 SV=1 1 130 1.0E-37
sp|Q977V0|RS8_METIG 30S ribosomal protein S8 OS=Methanotorris igneus GN=rps8 PE=3 SV=1 7 130 1.0E-37
sp|Q8TW15|RS8_METKA 30S ribosomal protein S8 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps8 PE=3 SV=1 1 130 2.0E-37
sp|A7I5Q4|RS8_METB6 30S ribosomal protein S8 OS=Methanoregula boonei (strain 6A8) GN=rps8 PE=3 SV=1 1 130 2.0E-37
sp|B6YSM9|RS8_THEON 30S ribosomal protein S8 OS=Thermococcus onnurineus (strain NA1) GN=rps8 PE=3 SV=1 1 130 2.0E-37
sp|Q12ZT6|RS8_METBU 30S ribosomal protein S8 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps8 PE=3 SV=1 1 130 2.0E-37
sp|A1RWS0|RS8_THEPD 30S ribosomal protein S8 OS=Thermofilum pendens (strain Hrk 5) GN=rps8 PE=3 SV=1 5 130 2.0E-37
sp|Q8TRT2|RS8_METAC 30S ribosomal protein S8 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps8 PE=3 SV=1 1 130 3.0E-37
sp|A1RVN1|RS8_PYRIL 30S ribosomal protein S8 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps8 PE=3 SV=1 1 130 4.0E-37
sp|B1L781|RS8_KORCO 30S ribosomal protein S8 OS=Korarchaeum cryptofilum (strain OPF8) GN=rps8 PE=3 SV=1 1 130 6.0E-37
sp|Q5JJG3|RS8_THEKO 30S ribosomal protein S8 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps8 PE=3 SV=1 1 130 1.0E-36
sp|A4WMD9|RS8_PYRAR 30S ribosomal protein S8 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps8 PE=3 SV=1 1 130 1.0E-36
sp|A2BMD4|RS8_HYPBU 30S ribosomal protein S8 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps8 PE=3 SV=1 1 130 2.0E-36
sp|B8D5V5|RS8_DESK1 30S ribosomal protein S8 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rps8 PE=3 SV=1 1 130 6.0E-36
sp|A4YCY1|RS8_METS5 30S ribosomal protein S8 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps8 PE=3 SV=1 1 130 1.0E-35
sp|Q8ZVW0|RS8_PYRAE 30S ribosomal protein S8 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps8 PE=3 SV=1 1 130 1.0E-35
sp|P54041|RS8_METJA 30S ribosomal protein S8 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps8 PE=1 SV=1 7 130 1.0E-35
sp|Q975J5|RS8_SULTO 30S ribosomal protein S8 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps8 PE=3 SV=1 1 130 3.0E-35
sp|O82205|R15A2_ARATH 40S ribosomal protein S15a-2 OS=Arabidopsis thaliana GN=RPS15AB PE=2 SV=1 6 130 5.0E-35
sp|Q9HIS2|RS8_THEAC 30S ribosomal protein S8 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps8 PE=3 SV=1 2 130 2.0E-34
sp|O26126|RS8_METTH 30S ribosomal protein S8 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps8 PE=3 SV=2 1 130 2.0E-34
sp|Q9UX92|RS8_SULSO 30S ribosomal protein S8 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps8 PE=3 SV=1 1 130 2.0E-34
sp|C3NEF8|RS8_SULIY 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rps8 PE=3 SV=1 1 130 4.0E-34
sp|C3NH94|RS8_SULIN 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps8 PE=3 SV=1 1 130 4.0E-34
sp|C3MVJ3|RS8_SULIM 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rps8 PE=3 SV=1 1 130 4.0E-34
sp|C3MQ74|RS8_SULIL 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rps8 PE=3 SV=1 1 130 4.0E-34
sp|C4KHH1|RS8_SULIK 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rps8 PE=3 SV=1 1 130 4.0E-34
sp|C3N5U2|RS8_SULIA 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain M.16.27) GN=rps8 PE=3 SV=1 1 130 4.0E-34
sp|Q97BW1|RS8_THEVO 30S ribosomal protein S8 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps8 PE=3 SV=1 2 130 4.0E-34
sp|O05636|RS8_SULAC 30S ribosomal protein S8 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps8 PE=3 SV=1 1 130 4.0E-34
sp|Q2FSG2|RS8_METHJ 30S ribosomal protein S8 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps8 PE=3 SV=1 1 130 7.0E-34
sp|A5UL73|RS8_METS3 30S ribosomal protein S8 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps8 PE=3 SV=1 7 130 2.0E-33
sp|Q977U8|RS8_METTL 30S ribosomal protein S8 OS=Methanothermococcus thermolithotrophicus GN=rps8 PE=3 SV=1 1 130 3.0E-33
sp|A6UQ59|RS8_METVS 30S ribosomal protein S8 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps8 PE=3 SV=1 7 130 5.0E-33
sp|P14038|RS8_METVA 30S ribosomal protein S8 OS=Methanococcus vannielii GN=rps8 PE=3 SV=1 7 130 5.0E-33
sp|Q6L1B2|RS8_PICTO 30S ribosomal protein S8 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps8 PE=3 SV=1 7 130 3.0E-32
sp|Q977U9|RS8_METVO 30S ribosomal protein S8 OS=Methanococcus voltae GN=rps8 PE=3 SV=1 1 130 4.0E-32
sp|Q6LXD8|RS8_METMP 30S ribosomal protein S8 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps8 PE=3 SV=1 1 130 5.0E-32
sp|A4FWA6|RS8_METM5 30S ribosomal protein S8 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps8 PE=3 SV=1 1 130 5.0E-32
sp|B9LSR2|RS8_HALLT 30S ribosomal protein S8 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rps8 PE=3 SV=1 1 130 9.0E-32
sp|A6UWV3|RS8_META3 30S ribosomal protein S8 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps8 PE=3 SV=1 7 130 1.0E-31
sp|A6VH00|RS8_METM7 30S ribosomal protein S8 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps8 PE=3 SV=1 1 130 2.0E-31
sp|Q18GG4|RS8_HALWD 30S ribosomal protein S8 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps8 PE=3 SV=1 1 130 2.0E-31
sp|A9A9P9|RS8_METM6 30S ribosomal protein S8 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps8 PE=3 SV=1 1 130 2.0E-31
sp|Q3IMX3|RS8_NATPD 30S ribosomal protein S8 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps8 PE=3 SV=1 1 130 5.0E-31
sp|O28369|RS8_ARCFU 30S ribosomal protein S8 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps8 PE=3 SV=2 6 130 5.0E-31
sp|P12742|RS8_HALMA 30S ribosomal protein S8 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps8 PE=1 SV=3 1 130 7.0E-31
sp|A8ACD7|RS8_IGNH4 30S ribosomal protein S8 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps8 PE=3 SV=1 1 130 1.0E-30
sp|Q2NFX2|RS8_METST 30S ribosomal protein S8 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps8 PE=3 SV=1 7 130 1.0E-30
sp|Q9HPB9|RS8_HALSA 30S ribosomal protein S8 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps8 PE=3 SV=2 1 130 5.0E-30
sp|B0R671|RS8_HALS3 30S ribosomal protein S8 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps8 PE=3 SV=1 1 130 5.0E-30
sp|A9A5I0|RS8_NITMS 30S ribosomal protein S8 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps8 PE=3 SV=1 1 130 6.0E-30
sp|Q9YF89|RS8_AERPE 30S ribosomal protein S8 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps8 PE=3 SV=2 1 130 3.0E-29
sp|A0RVY8|RS8_CENSY 30S ribosomal protein S8 OS=Cenarchaeum symbiosum (strain A) GN=rps8 PE=3 SV=1 1 130 9.0E-26
sp|Q74NG1|RS8_NANEQ 30S ribosomal protein S8 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps8 PE=3 SV=1 5 130 5.0E-23
sp|B2V7J9|RS8_SULSY 30S ribosomal protein S8 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsH PE=3 SV=1 4 130 2.0E-12
sp|B2A4F3|RS8_NATTJ 30S ribosomal protein S8 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsH PE=3 SV=1 1 130 7.0E-12
sp|A8YXL9|RS8_LACH4 30S ribosomal protein S8 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsH PE=3 SV=1 1 130 3.0E-11
sp|Q5FM77|RS8_LACAC 30S ribosomal protein S8 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsH PE=3 SV=1 1 130 5.0E-11
sp|Q03ZN2|RS8_LEUMM 30S ribosomal protein S8 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsH PE=3 SV=1 1 130 1.0E-10
sp|A3DJI6|RS8_CLOTH 30S ribosomal protein S8 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsH PE=3 SV=1 1 130 2.0E-10
sp|Q04C01|RS8_LACDB 30S ribosomal protein S8 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsH PE=3 SV=1 1 130 5.0E-10
sp|Q1GBK4|RS8_LACDA 30S ribosomal protein S8 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsH PE=3 SV=1 1 130 5.0E-10
sp|B3WAK4|RS8_LACCB 30S ribosomal protein S8 OS=Lactobacillus casei (strain BL23) GN=rpsH PE=3 SV=1 1 130 8.0E-10
sp|Q034Z7|RS8_LACC3 30S ribosomal protein S8 OS=Lactobacillus casei (strain ATCC 334) GN=rpsH PE=3 SV=1 1 130 8.0E-10
sp|B5E6G9|RS8_STRP4 30S ribosomal protein S8 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|C1CPA2|RS8_STRZT 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|C1CIB1|RS8_STRZP 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain P1031) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|C1CC20|RS8_STRZJ 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain JJA) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|P66633|RS8_STRR6 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|B2IS54|RS8_STRPS 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|P66632|RS8_STRPN 30S ribosomal protein S8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|B8ZKP4|RS8_STRPJ 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|B1I8L2|RS8_STRPI 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|C1CAM6|RS8_STRP7 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain 70585) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|Q04MM2|RS8_STRP2 30S ribosomal protein S8 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|Q046B2|RS8_LACGA 30S ribosomal protein S8 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|Q74L76|RS8_LACJO 30S ribosomal protein S8 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsH PE=3 SV=1 1 130 1.0E-09
sp|Q03IG5|RS8_STRTD 30S ribosomal protein S8 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|Q5M2C7|RS8_STRT2 30S ribosomal protein S8 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|Q5LXS5|RS8_STRT1 30S ribosomal protein S8 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|B1I1K2|RS8_DESAP 30S ribosomal protein S8 OS=Desulforudis audaxviator (strain MP104C) GN=rpsH PE=3 SV=1 4 130 3.0E-09
sp|Q67JV7|RS8_SYMTH 30S ribosomal protein S8 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|C0MCC4|RS8_STRS7 30S ribosomal protein S8 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|B4U514|RS8_STREM 30S ribosomal protein S8 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|C0MAG4|RS8_STRE4 30S ribosomal protein S8 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|B0K5Q7|RS8_THEPX 30S ribosomal protein S8 OS=Thermoanaerobacter sp. (strain X514) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|B0KCL4|RS8_THEP3 30S ribosomal protein S8 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|Q8R7W8|RS8_CALS4 30S ribosomal protein S8 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|Q83FZ9|RS8_TROWT 30S ribosomal protein S8 OS=Tropheryma whipplei (strain Twist) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|Q83I65|RS8_TROW8 30S ribosomal protein S8 OS=Tropheryma whipplei (strain TW08/27) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|A8AZL1|RS8_STRGC 30S ribosomal protein S8 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|A3CK77|RS8_STRSV 30S ribosomal protein S8 OS=Streptococcus sanguinis (strain SK36) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|Q839F0|RS8_ENTFA 30S ribosomal protein S8 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|B9DSW4|RS8_STRU0 30S ribosomal protein S8 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsH PE=3 SV=1 1 130 6.0E-09
sp|Q2RFR1|RS8_MOOTA 30S ribosomal protein S8 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsH PE=3 SV=1 4 130 1.0E-08
sp|P0DF01|RS8_STRPQ 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q48VT5|RS8_STRPM 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|A2RC28|RS8_STRPG 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q1J8Z9|RS8_STRPF 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q1JJ48|RS8_STRPD 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q1JP03|RS8_STRPC 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q1JE45|RS8_STRPB 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|P66636|RS8_STRP8 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q5XEC1|RS8_STRP6 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|P0DF00|RS8_STRP3 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|P66634|RS8_STRP1 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M1 GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q9Z9K0|RS8_BACHD 30S ribosomal protein S8 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsH PE=3 SV=3 1 130 1.0E-08
sp|Q1WSA4|RS8_LACS1 30S ribosomal protein S8 OS=Lactobacillus salivarius (strain UCC118) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q5L409|RS8_GEOKA 30S ribosomal protein S8 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsH PE=3 SV=2 1 130 1.0E-08
sp|B1MW01|RS8_LEUCK 30S ribosomal protein S8 OS=Leuconostoc citreum (strain KM20) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|B5XJ50|RS8_STRPZ 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|B4UBB3|RS8_ANASK 30S ribosomal protein S8 OS=Anaeromyxobacter sp. (strain K) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|B8J874|RS8_ANAD2 30S ribosomal protein S8 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|Q8E7S7|RS8_STRA3 30S ribosomal protein S8 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|Q3K3V5|RS8_STRA1 30S ribosomal protein S8 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|C5CGI8|RS8_KOSOT 30S ribosomal protein S8 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsH PE=3 SV=1 7 130 2.0E-08
sp|A9BG04|RS8_PETMO 30S ribosomal protein S8 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsH PE=3 SV=1 7 130 2.0E-08
sp|A7HBN2|RS8_ANADF 30S ribosomal protein S8 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|P56209|RS8_GEOSE 30S ribosomal protein S8 OS=Geobacillus stearothermophilus GN=rpsH PE=1 SV=2 1 128 3.0E-08
sp|B7GJ81|RS8_ANOFW 30S ribosomal protein S8 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q8E2C0|RS8_STRA5 30S ribosomal protein S8 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsH PE=3 SV=1 1 130 4.0E-08
sp|B1VAD4|RS8_PHYAS 30S ribosomal protein S8 OS=Phytoplasma australiense GN=rpsH PE=3 SV=1 1 130 4.0E-08
sp|Q8YPJ2|RS8_NOSS1 30S ribosomal protein S8 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsH PE=3 SV=1 1 130 4.0E-08
sp|C0QQN7|RS8_PERMH 30S ribosomal protein S8 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsH PE=3 SV=1 4 130 5.0E-08
sp|Q8ETW9|RS8_OCEIH 30S ribosomal protein S8 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsH PE=3 SV=1 1 130 5.0E-08
sp|Q65P93|RS8_BACLD 30S ribosomal protein S8 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsH PE=3 SV=1 1 130 5.0E-08
sp|Q0AUJ4|RS8_SYNWW 30S ribosomal protein S8 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsH PE=3 SV=1 1 130 5.0E-08
sp|Q2IJ72|RS8_ANADE 30S ribosomal protein S8 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsH PE=3 SV=1 1 130 5.0E-08
sp|A4IJK2|RS8_GEOTN 30S ribosomal protein S8 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsH PE=3 SV=1 1 130 6.0E-08
sp|Q98PZ6|RS8_MYCPU 30S ribosomal protein S8 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsH PE=3 SV=1 4 130 6.0E-08
sp|A4XLR6|RS8_CALS8 30S ribosomal protein S8 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsH PE=3 SV=1 7 130 6.0E-08
sp|A0ALV4|RS8_LISW6 30S ribosomal protein S8 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|P66623|RS8_LISMO 30S ribosomal protein S8 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|B8DB22|RS8_LISMH 30S ribosomal protein S8 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|Q71WG0|RS8_LISMF 30S ribosomal protein S8 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|C1KZG6|RS8_LISMC 30S ribosomal protein S8 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|P66624|RS8_LISIN 30S ribosomal protein S8 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|A5D5G8|RS8_PELTS 30S ribosomal protein S8 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|Q21M44|RS8_SACD2 30S ribosomal protein S8 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsH PE=3 SV=1 7 126 7.0E-08
sp|Q2NIW8|RS8_AYWBP 30S ribosomal protein S8 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|A4VSG7|RS8_STRSY 30S ribosomal protein S8 OS=Streptococcus suis (strain 05ZYH33) GN=rpsH PE=3 SV=1 1 130 8.0E-08
sp|A4VYQ6|RS8_STRS2 30S ribosomal protein S8 OS=Streptococcus suis (strain 98HAH33) GN=rpsH PE=3 SV=1 1 130 8.0E-08
sp|Q3A9T0|RS8_CARHZ 30S ribosomal protein S8 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsH PE=3 SV=1 1 130 8.0E-08
sp|Q6YR08|RS8_ONYPE 30S ribosomal protein S8 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsH PE=3 SV=1 1 130 8.0E-08
sp|C5D3T1|RS8_GEOSW 30S ribosomal protein S8 OS=Geobacillus sp. (strain WCH70) GN=rpsH PE=3 SV=1 1 130 9.0E-08
sp|C0ZIJ4|RS8_BREBN 30S ribosomal protein S8 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsH PE=3 SV=1 1 130 9.0E-08
sp|A4J125|RS8_DESRM 30S ribosomal protein S8 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|B0V6V9|RS8_ACIBY 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain AYE) GN=rpsH PE=3 SV=1 1 128 1.0E-07
sp|A3M970|RS8_ACIBT 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsH PE=3 SV=2 1 128 1.0E-07
sp|B0VQT2|RS8_ACIBS 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain SDF) GN=rpsH PE=3 SV=1 1 128 1.0E-07
sp|B7IA25|RS8_ACIB5 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain AB0057) GN=rpsH PE=3 SV=1 1 128 1.0E-07
sp|B7GW16|RS8_ACIB3 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsH PE=3 SV=1 1 128 1.0E-07
sp|Q3MFA8|RS8_ANAVT 30S ribosomal protein S8 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|Q38US5|RS8_LACSS 30S ribosomal protein S8 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|B9JVQ1|RS8_AGRVS 30S ribosomal protein S8 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsH PE=3 SV=1 1 126 1.0E-07
sp|P12879|RS8_BACSU 30S ribosomal protein S8 OS=Bacillus subtilis (strain 168) GN=rpsH PE=1 SV=4 1 130 1.0E-07
sp|B4SKX7|RS8_STRM5 30S ribosomal protein S8 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsH PE=3 SV=1 1 128 1.0E-07
sp|B2FQJ8|RS8_STRMK 30S ribosomal protein S8 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsH PE=3 SV=1 1 128 1.0E-07
sp|B0TC70|RS8_HELMI 30S ribosomal protein S8 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsH PE=3 SV=1 1 130 2.0E-07
sp|A8SED9|RR8_CERDE 30S ribosomal protein S8, chloroplastic OS=Ceratophyllum demersum GN=rps8 PE=3 SV=1 6 130 2.0E-07
sp|Q82X77|RS8_NITEU 30S ribosomal protein S8 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsH PE=3 SV=1 1 126 2.0E-07
sp|Q05HS7|RS8_XANOR 30S ribosomal protein S8 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsH PE=3 SV=1 1 128 2.0E-07
sp|Q2NZZ9|RS8_XANOM 30S ribosomal protein S8 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsH PE=3 SV=1 1 128 2.0E-07
sp|A8F999|RS8_BACP2 30S ribosomal protein S8 OS=Bacillus pumilus (strain SAFR-032) GN=rpsH PE=3 SV=1 1 130 2.0E-07
sp|B1LBM6|RS8_THESQ 30S ribosomal protein S8 OS=Thermotoga sp. (strain RQ2) GN=rpsH PE=3 SV=1 7 130 2.0E-07
sp|A5IM97|RS8_THEP1 30S ribosomal protein S8 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsH PE=3 SV=1 7 130 2.0E-07
sp|C4KZN2|RS8_EXISA 30S ribosomal protein S8 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsH PE=3 SV=1 1 130 2.0E-07
sp|B1YGW4|RS8_EXIS2 30S ribosomal protein S8 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsH PE=3 SV=1 1 130 2.0E-07
sp|A7Z0Q2|RS8_BACMF 30S ribosomal protein S8 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsH PE=3 SV=1 1 130 2.0E-07
sp|B0JHZ0|RS8_MICAN 30S ribosomal protein S8 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsH PE=3 SV=1 1 130 3.0E-07
sp|Q11HR6|RS8_CHESB 30S ribosomal protein S8 OS=Chelativorans sp. (strain BNC1) GN=rpsH PE=3 SV=1 7 126 3.0E-07
sp|A4SSZ2|RS8_AERS4 30S ribosomal protein S8 OS=Aeromonas salmonicida (strain A449) GN=rpsH PE=3 SV=1 7 128 3.0E-07
sp|Q1AU43|RS8_RUBXD 30S ribosomal protein S8 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsH PE=3 SV=1 1 130 3.0E-07
sp|Q03PX1|RS8_LACBA 30S ribosomal protein S8 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsH PE=3 SV=1 1 130 3.0E-07
sp|B8I7Z3|RS8_CLOCE 30S ribosomal protein S8 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsH PE=3 SV=1 4 130 4.0E-07
sp|A6LEH7|RS8_PARD8 30S ribosomal protein S8 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsH PE=3 SV=1 4 130 4.0E-07
sp|B5YG33|RS8_THEYD 30S ribosomal protein S8 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsH PE=3 SV=1 4 130 4.0E-07
sp|B6YQ71|RS8_AZOPC 30S ribosomal protein S8 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsH PE=3 SV=1 4 130 4.0E-07
sp|Q605C6|RS8_METCA 30S ribosomal protein S8 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsH PE=3 SV=1 1 126 4.0E-07
sp|B2S2F0|RS8_TREPS 30S ribosomal protein S8 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsH PE=3 SV=1 9 126 4.0E-07
sp|O83233|RS8_TREPA 30S ribosomal protein S8 OS=Treponema pallidum (strain Nichols) GN=rpsH PE=3 SV=1 9 126 4.0E-07
sp|A5IYX2|RS8_MYCAP 30S ribosomal protein S8 OS=Mycoplasma agalactiae (strain PG2) GN=rpsH PE=3 SV=1 1 130 5.0E-07
sp|B9K8A0|RS8_THENN 30S ribosomal protein S8 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsH PE=3 SV=1 7 130 5.0E-07
sp|Q9ZAE5|RS8_THEMA 30S ribosomal protein S8 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsH PE=3 SV=2 7 130 5.0E-07
sp|A4GYU6|RR8_POPTR 30S ribosomal protein S8, chloroplastic OS=Populus trichocarpa GN=rps8 PE=3 SV=1 5 130 5.0E-07
sp|Q14FC2|RR8_POPAL 30S ribosomal protein S8, chloroplastic OS=Populus alba GN=rps8 PE=3 SV=1 5 130 5.0E-07
sp|A0KF35|RS8_AERHH 30S ribosomal protein S8 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsH PE=3 SV=1 7 128 6.0E-07
sp|Q6F7S6|RS8_ACIAD 30S ribosomal protein S8 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsH PE=3 SV=1 1 128 7.0E-07
sp|Q4AAF4|RS8_MYCHJ 30S ribosomal protein S8 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpsH PE=3 SV=1 4 130 7.0E-07
sp|Q4A8I5|RS8_MYCH7 30S ribosomal protein S8 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsH PE=3 SV=1 4 130 7.0E-07
sp|Q601K0|RS8_MYCH2 30S ribosomal protein S8 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsH PE=3 SV=2 4 130 7.0E-07
sp|Q02W39|RS8_LACLS 30S ribosomal protein S8 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsH PE=3 SV=1 1 130 8.0E-07
sp|A2RNN9|RS8_LACLM 30S ribosomal protein S8 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsH PE=3 SV=1 1 130 8.0E-07
sp|A7GK34|RS8_BACCN 30S ribosomal protein S8 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsH PE=3 SV=1 1 130 8.0E-07
sp|Q04G72|RS8_OENOB 30S ribosomal protein S8 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsH PE=3 SV=1 1 130 9.0E-07
sp|Q2N9C5|RS8_ERYLH 30S ribosomal protein S8 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsH PE=3 SV=1 1 130 9.0E-07
sp|Q8DS27|RS8_STRMU 30S ribosomal protein S8 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsH PE=3 SV=1 1 130 9.0E-07
sp|B9MKG7|RS8_CALBD 30S ribosomal protein S8 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsH PE=3 SV=1 7 130 9.0E-07
sp|Q6CZY4|RS8_PECAS 30S ribosomal protein S8 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsH PE=3 SV=1 7 128 9.0E-07
sp|B3E7U9|RS8_GEOLS 30S ribosomal protein S8 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|A1ALV5|RS8_PELPD 30S ribosomal protein S8 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|Q03ED0|RS8_PEDPA 30S ribosomal protein S8 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|B2VK82|RS8_ERWT9 30S ribosomal protein S8 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsH PE=3 SV=1 7 128 1.0E-06
sp|B3PMN3|RS8_MYCA5 30S ribosomal protein S8 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rpsH PE=3 SV=1 29 130 1.0E-06
sp|Q488Z9|RS8_COLP3 30S ribosomal protein S8 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsH PE=3 SV=1 4 128 1.0E-06
sp|A2BYS3|RS8_PROM5 30S ribosomal protein S8 OS=Prochlorococcus marinus (strain MIT 9515) GN=rpsH PE=3 SV=1 7 130 1.0E-06
sp|Q9CDX7|RS8_LACLA 30S ribosomal protein S8 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|C6DG60|RS8_PECCP 30S ribosomal protein S8 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|A5N4R1|RS8_CLOK5 30S ribosomal protein S8 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsH PE=3 SV=1 1 130 2.0E-06
sp|B9DYC3|RS8_CLOK1 30S ribosomal protein S8 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsH PE=3 SV=1 1 130 2.0E-06
sp|Q3YWV3|RS8_SHISS 30S ribosomal protein S8 OS=Shigella sonnei (strain Ss046) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|P0A7X2|RS8_SHIFL 30S ribosomal protein S8 OS=Shigella flexneri GN=rpsH PE=3 SV=2 7 128 2.0E-06
sp|Q0SZZ6|RS8_SHIF8 30S ribosomal protein S8 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|Q32B45|RS8_SHIDS 30S ribosomal protein S8 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|Q31VX0|RS8_SHIBS 30S ribosomal protein S8 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B2U2S4|RS8_SHIB3 30S ribosomal protein S8 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|P0A7X0|RS8_SALTY 30S ribosomal protein S8 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsH PE=3 SV=2 7 128 2.0E-06
sp|P0A7X1|RS8_SALTI 30S ribosomal protein S8 OS=Salmonella typhi GN=rpsH PE=3 SV=2 7 128 2.0E-06
sp|B4TXC8|RS8_SALSV 30S ribosomal protein S8 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B5BGX2|RS8_SALPK 30S ribosomal protein S8 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|A9MSY4|RS8_SALPB 30S ribosomal protein S8 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|Q5PIU7|RS8_SALPA 30S ribosomal protein S8 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsH PE=3 SV=3 7 128 2.0E-06
sp|B4SUS6|RS8_SALNS 30S ribosomal protein S8 OS=Salmonella newport (strain SL254) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B4TKK1|RS8_SALHS 30S ribosomal protein S8 OS=Salmonella heidelberg (strain SL476) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B5RH29|RS8_SALG2 30S ribosomal protein S8 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B5R1G3|RS8_SALEP 30S ribosomal protein S8 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B5FJK0|RS8_SALDC 30S ribosomal protein S8 OS=Salmonella dublin (strain CT_02021853) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|Q57J46|RS8_SALCH 30S ribosomal protein S8 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B5F7T1|RS8_SALA4 30S ribosomal protein S8 OS=Salmonella agona (strain SL483) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B7LRS2|RS8_ESCF3 30S ribosomal protein S8 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|Q1R622|RS8_ECOUT 30S ribosomal protein S8 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B1LHC0|RS8_ECOSM 30S ribosomal protein S8 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B6I220|RS8_ECOSE 30S ribosomal protein S8 OS=Escherichia coli (strain SE11) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B7NDS7|RS8_ECOLU 30S ribosomal protein S8 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|P0A7W7|RS8_ECOLI 30S ribosomal protein S8 OS=Escherichia coli (strain K12) GN=rpsH PE=1 SV=2 7 128 2.0E-06
sp|B1IPZ3|RS8_ECOLC 30S ribosomal protein S8 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|P0A7W8|RS8_ECOL6 30S ribosomal protein S8 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsH PE=3 SV=2 7 128 2.0E-06
sp|Q0TCF5|RS8_ECOL5 30S ribosomal protein S8 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|A1AGJ5|RS8_ECOK1 30S ribosomal protein S8 OS=Escherichia coli O1:K1 / APEC GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|A8A5B1|RS8_ECOHS 30S ribosomal protein S8 OS=Escherichia coli O9:H4 (strain HS) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B1X6F8|RS8_ECODH 30S ribosomal protein S8 OS=Escherichia coli (strain K12 / DH10B) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|C4ZUG1|RS8_ECOBW 30S ribosomal protein S8 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B7M1M0|RS8_ECO8A 30S ribosomal protein S8 OS=Escherichia coli O8 (strain IAI1) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B7N190|RS8_ECO81 30S ribosomal protein S8 OS=Escherichia coli O81 (strain ED1a) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B7NLM5|RS8_ECO7I 30S ribosomal protein S8 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B5YTM7|RS8_ECO5E 30S ribosomal protein S8 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|P0A7W9|RS8_ECO57 30S ribosomal protein S8 OS=Escherichia coli O157:H7 GN=rpsH PE=3 SV=2 7 128 2.0E-06
sp|B7L4J4|RS8_ECO55 30S ribosomal protein S8 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B7MCS1|RS8_ECO45 30S ribosomal protein S8 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|B7UK30|RS8_ECO27 30S ribosomal protein S8 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|A7ZSJ5|RS8_ECO24 30S ribosomal protein S8 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|A8AQK2|RS8_CITK8 30S ribosomal protein S8 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsH PE=3 SV=1 7 128 2.0E-06
sp|Q06GW1|RR8_DRIGR 30S ribosomal protein S8, chloroplastic OS=Drimys granadensis GN=rps8 PE=3 SV=1 5 130 2.0E-06
sp|A6LLM7|RS8_THEM4 30S ribosomal protein S8 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsH PE=3 SV=1 7 130 3.0E-06
sp|A0LIK4|RS8_SYNFM 30S ribosomal protein S8 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsH PE=3 SV=1 1 126 3.0E-06
sp|B8HMR7|RS8_CYAP4 30S ribosomal protein S8 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q6HPP4|RS8_BACHK 30S ribosomal protein S8 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q63H76|RS8_BACCZ 30S ribosomal protein S8 OS=Bacillus cereus (strain ZK / E33L) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q81J28|RS8_BACCR 30S ribosomal protein S8 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B9IZK8|RS8_BACCQ 30S ribosomal protein S8 OS=Bacillus cereus (strain Q1) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B7HQV8|RS8_BACC7 30S ribosomal protein S8 OS=Bacillus cereus (strain AH187) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B7HJ62|RS8_BACC4 30S ribosomal protein S8 OS=Bacillus cereus (strain B4264) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|C1ET53|RS8_BACC3 30S ribosomal protein S8 OS=Bacillus cereus (strain 03BB102) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B7IT33|RS8_BACC2 30S ribosomal protein S8 OS=Bacillus cereus (strain G9842) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q73F82|RS8_BACC1 30S ribosomal protein S8 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B7JKD3|RS8_BACC0 30S ribosomal protein S8 OS=Bacillus cereus (strain AH820) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q81VR6|RS8_BACAN 30S ribosomal protein S8 OS=Bacillus anthracis GN=rpsH PE=1 SV=1 1 130 3.0E-06
sp|A0R8J4|RS8_BACAH 30S ribosomal protein S8 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsH PE=3 SV=2 1 130 3.0E-06
sp|C3LJ96|RS8_BACAC 30S ribosomal protein S8 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|C3P9R9|RS8_BACAA 30S ribosomal protein S8 OS=Bacillus anthracis (strain A0248) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|A4QLE1|RR8_LEPVR 30S ribosomal protein S8, chloroplastic OS=Lepidium virginicum GN=rps8 PE=3 SV=1 6 130 3.0E-06
sp|Q3IJJ9|RS8_PSEHT 30S ribosomal protein S8 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsH PE=3 SV=1 7 128 3.0E-06
sp|B3EUK9|RS8_AMOA5 30S ribosomal protein S8 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsH PE=3 SV=1 4 130 3.0E-06
sp|B1HMW6|RS8_LYSSC 30S ribosomal protein S8 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q5WLP8|RS8_BACSK 30S ribosomal protein S8 OS=Bacillus clausii (strain KSM-K16) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q2G8W6|RS8_NOVAD 30S ribosomal protein S8 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|A5V5Y8|RS8_SPHWW 30S ribosomal protein S8 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q4G354|RR8_EMIHU 30S ribosomal protein S8, chloroplastic OS=Emiliania huxleyi GN=rps8 PE=3 SV=1 6 129 3.0E-06
sp|Q6XYX4|RS8_SPIKU 30S ribosomal protein S8 OS=Spiroplasma kunkelii GN=rpsH PE=3 SV=1 7 130 3.0E-06
sp|Q4L8A0|RS8_STAHJ 30S ribosomal protein S8 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsH PE=3 SV=1 1 130 4.0E-06
sp|Q85FV0|RR8_CYAME 30S ribosomal protein S8, chloroplastic OS=Cyanidioschyzon merolae GN=rps8 PE=3 SV=1 7 130 4.0E-06
sp|Q8CRH4|RS8_STAES 30S ribosomal protein S8 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsH PE=3 SV=1 1 130 4.0E-06
sp|Q5HM13|RS8_STAEQ 30S ribosomal protein S8 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsH PE=3 SV=1 1 130 4.0E-06
sp|A8MLF4|RS8_ALKOO 30S ribosomal protein S8 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsH PE=3 SV=1 1 130 4.0E-06
sp|B5XNA7|RS8_KLEP3 30S ribosomal protein S8 OS=Klebsiella pneumoniae (strain 342) GN=rpsH PE=3 SV=1 7 128 4.0E-06
sp|A8GPD6|RS8_RICAH 30S ribosomal protein S8 OS=Rickettsia akari (strain Hartford) GN=rpsH PE=3 SV=1 1 126 4.0E-06
sp|Q92QF6|RS8_RHIME 30S ribosomal protein S8 OS=Rhizobium meliloti (strain 1021) GN=rpsH PE=3 SV=1 1 130 5.0E-06
sp|A8G748|RS8_PROM2 30S ribosomal protein S8 OS=Prochlorococcus marinus (strain MIT 9215) GN=rpsH PE=3 SV=1 7 130 5.0E-06
sp|A7MPG4|RS8_CROS8 30S ribosomal protein S8 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsH PE=3 SV=1 7 128 5.0E-06
sp|B7IHW0|RS8_THEAB 30S ribosomal protein S8 OS=Thermosipho africanus (strain TCF52B) GN=rpsH PE=3 SV=1 7 130 6.0E-06
sp|A1JS16|RS8_YERE8 30S ribosomal protein S8 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|Q7UZV7|RS8_PROMP 30S ribosomal protein S8 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpsH PE=3 SV=1 7 130 7.0E-06
sp|A3PF34|RS8_PROM0 30S ribosomal protein S8 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsH PE=3 SV=1 7 130 7.0E-06
sp|A6H5L7|RR8_CYCTA 30S ribosomal protein S8, chloroplastic OS=Cycas taitungensis GN=rps8 PE=3 SV=1 6 128 7.0E-06
sp|Q7VKE7|RS8_HAEDU 30S ribosomal protein S8 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsH PE=3 SV=1 7 128 7.0E-06
sp|A0T0J2|RR8_PHATC 30S ribosomal protein S8, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps8 PE=3 SV=1 7 130 8.0E-06
sp|A4QJN4|RR8_AETGR 30S ribosomal protein S8, chloroplastic OS=Aethionema grandiflorum GN=rps8 PE=3 SV=1 6 130 8.0E-06
sp|Q318J7|RS8_PROM9 30S ribosomal protein S8 OS=Prochlorococcus marinus (strain MIT 9312) GN=rpsH PE=3 SV=1 7 130 8.0E-06
sp|Q88XX2|RS8_LACPL 30S ribosomal protein S8 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsH PE=3 SV=1 4 130 8.0E-06
sp|A6KYI1|RS8_BACV8 30S ribosomal protein S8 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsH PE=3 SV=1 4 130 9.0E-06
sp|B0RZS3|RS8_FINM2 30S ribosomal protein S8 OS=Finegoldia magna (strain ATCC 29328) GN=rpsH PE=3 SV=1 4 130 9.0E-06
sp|Q47LK7|RS8_THEFY 30S ribosomal protein S8 OS=Thermobifida fusca (strain YX) GN=rpsH PE=3 SV=1 1 130 9.0E-06
sp|Q3A6N3|RS8_PELCD 30S ribosomal protein S8 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsH PE=3 SV=1 1 130 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5681
MVRTSVLHDALNSINNAEKSGKRQVLIRPSSKVIVKFLQVMQRHGYIGEFEEVDDHRSGKIVVQLNGRLNKTGVI
SPRYNVRLSELEKWVVKLLPARQFGYVILTTSAGIMDHEEARRKHVAGKIIGFFY*
Coding >OphauB2|5681
ATGGTTCGCACTTCGGTCCTCCACGATGCTCTCAACTCGATCAACAATGCCGAAAAGTCGGGAAAGCGCCAGGTC
TTGATCCGGCCCAGCTCCAAGGTGATTGTCAAGTTTCTGCAGGTCATGCAGCGCCATGGTTATATTGGCGAATTC
GAGGAGGTAGATGATCACCGCTCTGGCAAGATTGTGGTGCAGCTCAATGGACGTCTCAACAAGACTGGCGTCATC
TCCCCTCGATACAACGTGCGTCTGTCGGAGCTGGAGAAGTGGGTTGTCAAGCTGTTGCCTGCGCGTCAATTCGGC
TACGTTATCTTGACCACATCTGCTGGTATCATGGACCACGAGGAAGCTCGTCGGAAACACGTTGCCGGCAAGATT
ATTGGGTTTTTCTATTAG
Transcript >OphauB2|5681
ATGGTTCGCACTTCGGTCCTCCACGATGCTCTCAACTCGATCAACAATGCCGAAAAGTCGGGAAAGCGCCAGGTC
TTGATCCGGCCCAGCTCCAAGGTGATTGTCAAGTTTCTGCAGGTCATGCAGCGCCATGGTTATATTGGCGAATTC
GAGGAGGTAGATGATCACCGCTCTGGCAAGATTGTGGTGCAGCTCAATGGACGTCTCAACAAGACTGGCGTCATC
TCCCCTCGATACAACGTGCGTCTGTCGGAGCTGGAGAAGTGGGTTGTCAAGCTGTTGCCTGCGCGTCAATTCGGC
TACGTTATCTTGACCACATCTGCTGGTATCATGGACCACGAGGAAGCTCGTCGGAAACACGTTGCCGGCAAGATT
ATTGGGTTTTTCTATTAG
Gene >OphauB2|5681
ATGGTTCGCACTTCGGTCCTCCACGATGCTCTCAACTCGATCAACAATGCCGAAAAGTCGGGAAAGCGCCAGGTC
TTGATCCGGCCCAGCTCCAAGGTGATTGTCAAGTTTCTGCAGGTCATGCAGCGCCATGGTACGTGGGAGGTTTAT
TTTTGTCTCGTTGTTCGGCATCATAACTAGGGCTGCGGCCGAATCCTCACCACGCTTTGGCCCCTATAAGTTGCC
GATAGATCAAAGTCTCTACTGGGCTTGAACTTGGTTTTGCTTTATCTGTTTCCAGTTCACATGGCTCGAGTCTGT
GGCAACATACTGATGCGTGTCATGTATAGGTTATATTGGCGAATTCGAGGAGGTAGATGATCACCGCTCTGGCAA
GATTGTGGTGCAGCTCAATGGACGTCTCAACAAGACTGGCGTCATCTCCCCTCGATACAACGTGCGTCTGTCGGA
GCTGGAGAAGTGGGTTGTCAAGCTGTTGCCTGCGCGTCAATTCGGCTACGTTATCTTGACCACATCTGCTGGTAT
CATGGACCACGAGGAAGCTCGTCGGAAACACGTTGCCGGCAAGATTATTGGGTTTTTCTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail