Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5669
Gene name
LocationContig_46:11148..11495
Strand+
Gene length (bp)347
Transcript length (bp)288
Coding sequence length (bp)288
Protein length (aa) 96

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09803 Pet100 Pet100 1.9E-18 1 78

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38958|PT100_YEAST Protein PET100, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET100 PE=1 SV=1 6 80 1.0E-13

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0033617 mitochondrial cytochrome c oxidase assembly Yes
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No
GO:0065003 protein-containing complex assembly No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043933 protein-containing complex organization No
GO:0005575 cellular_component No
GO:0017004 cytochrome complex assembly No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0043227 membrane-bounded organelle No
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:0043226 organelle No
GO:0009987 cellular process No
GO:0043229 intracellular organelle No
GO:0071840 cellular component organization or biogenesis No
GO:0008535 respiratory chain complex IV assembly No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5934
Ophiocordyceps australis map64 (Brazil) OphauB2|5669 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05028
Ophiocordyceps camponoti-rufipedis Ophun1|4606
Ophiocordyceps kimflemingae Ophio5|2097
Ophiocordyceps subramaniannii Hirsu2|4923

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5669
MGGLNLEIFKFGTYVMFPIGIMYYFGTNLDNRFSVPNFWPKPEECNKVPRDREEVVAEYQRIVARQRLRQQRARE
EEMKLAASRPNTTQHSDKEL*
Coding >OphauB2|5669
ATGGGTGGCCTCAACTTGGAGATCTTCAAGTTTGGCACCTACGTCATGTTTCCAATCGGCATCATGTACTACTTT
GGCACCAATCTAGACAATCGCTTCTCGGTGCCGAATTTCTGGCCCAAGCCCGAGGAGTGTAATAAGGTGCCGCGC
GACCGAGAAGAAGTCGTAGCCGAGTACCAGCGCATCGTTGCACGGCAAAGGCTCCGACAGCAGAGAGCGCGAGAG
GAAGAGATGAAGCTGGCGGCGTCTAGGCCAAATACGACGCAGCACAGTGACAAGGAACTATAA
Transcript >OphauB2|5669
ATGGGTGGCCTCAACTTGGAGATCTTCAAGTTTGGCACCTACGTCATGTTTCCAATCGGCATCATGTACTACTTT
GGCACCAATCTAGACAATCGCTTCTCGGTGCCGAATTTCTGGCCCAAGCCCGAGGAGTGTAATAAGGTGCCGCGC
GACCGAGAAGAAGTCGTAGCCGAGTACCAGCGCATCGTTGCACGGCAAAGGCTCCGACAGCAGAGAGCGCGAGAG
GAAGAGATGAAGCTGGCGGCGTCTAGGCCAAATACGACGCAGCACAGTGACAAGGAACTATAA
Gene >OphauB2|5669
ATGGGTGGCCTCAACTTGGAGATCTTCAAGGTGTGTACCAGCCTCAGTAGCATCCCCGACTTTAAGAGCACTTTG
CTGACAGCTTCCAGTTTGGCACCTACGTCATGTTTCCAATCGGCATCATGTACTACTTTGGCACCAATCTAGACA
ATCGCTTCTCGGTGCCGAATTTCTGGCCCAAGCCCGAGGAGTGTAATAAGGTGCCGCGCGACCGAGAAGAAGTCG
TAGCCGAGTACCAGCGCATCGTTGCACGGCAAAGGCTCCGACAGCAGAGAGCGCGAGAGGAAGAGATGAAGCTGG
CGGCGTCTAGGCCAAATACGACGCAGCACAGTGACAAGGAACTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail