Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5666
Gene name
LocationContig_46:5281..5974
Strand+
Gene length (bp)693
Transcript length (bp)441
Coding sequence length (bp)441
Protein length (aa) 147

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01894 UPF0047 Uncharacterised protein family UPF0047 3.4E-37 20 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14155|YE72_SCHPO UPF0047 protein C4A8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.02c PE=3 SV=1 1 146 4.0E-48
sp|P0AF48|YJBQ_ECOLI UPF0047 protein YjbQ OS=Escherichia coli (strain K12) GN=yjbQ PE=3 SV=1 3 144 5.0E-46
sp|P0AF49|YJBQ_ECO57 UPF0047 protein YjbQ OS=Escherichia coli O157:H7 GN=yjbQ PE=3 SV=1 3 144 5.0E-46
sp|P0A2L1|YJBQ_SALTY UPF0047 protein YjbQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yjbQ PE=3 SV=1 3 144 3.0E-35
sp|P0A2L2|YJBQ_SALTI UPF0047 protein YjbQ OS=Salmonella typhi GN=yjbQ PE=3 SV=1 3 144 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14155|YE72_SCHPO UPF0047 protein C4A8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.02c PE=3 SV=1 1 146 4.0E-48
sp|P0AF48|YJBQ_ECOLI UPF0047 protein YjbQ OS=Escherichia coli (strain K12) GN=yjbQ PE=3 SV=1 3 144 5.0E-46
sp|P0AF49|YJBQ_ECO57 UPF0047 protein YjbQ OS=Escherichia coli O157:H7 GN=yjbQ PE=3 SV=1 3 144 5.0E-46
sp|P0A2L1|YJBQ_SALTY UPF0047 protein YjbQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yjbQ PE=3 SV=1 3 144 3.0E-35
sp|P0A2L2|YJBQ_SALTI UPF0047 protein YjbQ OS=Salmonella typhi GN=yjbQ PE=3 SV=1 3 144 3.0E-35
sp|P74125|Y1880_SYNY3 UPF0047 protein sll1880 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1880 PE=3 SV=1 35 144 4.0E-28
sp|Q58481|Y1081_METJA UPF0047 protein MJ1081 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1081 PE=3 SV=1 20 145 8.0E-17
sp|O28229|Y2050_ARCFU UPF0047 protein AF_2050 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2050 PE=3 SV=1 20 141 3.0E-14
sp|O05243|YUGU_BACSU UPF0047 protein YugU OS=Bacillus subtilis (strain 168) GN=yugU PE=3 SV=2 41 128 1.0E-13
sp|O26865|Y771_METTH UPF0047 protein MTH_771 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_771 PE=3 SV=1 1 135 4.0E-12
sp|P67122|Y2586_MYCBO UPF0047 protein Mb2586c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2586c PE=3 SV=1 37 137 8.0E-06
sp|P9WFP8|Y2556_MYCTO UPF0047 protein MT2633 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2633 PE=3 SV=1 37 137 8.0E-06
sp|P9WFP9|Y2556_MYCTU UPF0047 protein Rv2556c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2556c PE=1 SV=2 37 137 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1105
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|722
Ophiocordyceps australis map64 (Brazil) OphauB2|5666 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05031
Ophiocordyceps camponoti-rufipedis Ophun1|4603
Ophiocordyceps kimflemingae Ophio5|2100
Ophiocordyceps subramaniannii Hirsu2|1012

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5666
MSWFQKQFSLTSRSRGSYLVTDQILTALPEIREYKIGLLNLFVQHTSCALSLNENFDQDVRADMSDALDRIAPDQ
GPKGEQLYRHDAEGPDDMPAHIKSALIGASVTIPIKDGKLATGTWQGIWYLEFRASKHQRQIIATIQGEKS*
Coding >OphauB2|5666
ATGTCCTGGTTTCAGAAGCAGTTCTCTCTCACCTCTAGGTCTCGTGGATCTTATCTAGTCACTGATCAGATTCTC
ACTGCTCTGCCTGAGATTCGTGAATACAAGATTGGCTTGCTCAACCTCTTTGTGCAGCACACCAGCTGTGCTCTC
AGCCTAAATGAGAACTTTGATCAAGATGTCAGAGCAGACATGAGTGACGCGCTGGATCGAATCGCACCAGATCAA
GGTCCCAAGGGAGAGCAGCTTTATCGTCACGATGCTGAAGGGCCTGACGACATGCCAGCACACATCAAGTCAGCC
TTGATTGGTGCTAGCGTCACGATTCCAATCAAGGACGGGAAGTTGGCCACAGGCACTTGGCAGGGCATCTGGTAT
CTCGAGTTTAGGGCAAGCAAGCACCAGCGCCAAATAATAGCTACTATTCAGGGTGAAAAATCATGA
Transcript >OphauB2|5666
ATGTCCTGGTTTCAGAAGCAGTTCTCTCTCACCTCTAGGTCTCGTGGATCTTATCTAGTCACTGATCAGATTCTC
ACTGCTCTGCCTGAGATTCGTGAATACAAGATTGGCTTGCTCAACCTCTTTGTGCAGCACACCAGCTGTGCTCTC
AGCCTAAATGAGAACTTTGATCAAGATGTCAGAGCAGACATGAGTGACGCGCTGGATCGAATCGCACCAGATCAA
GGTCCCAAGGGAGAGCAGCTTTATCGTCACGATGCTGAAGGGCCTGACGACATGCCAGCACACATCAAGTCAGCC
TTGATTGGTGCTAGCGTCACGATTCCAATCAAGGACGGGAAGTTGGCCACAGGCACTTGGCAGGGCATCTGGTAT
CTCGAGTTTAGGGCAAGCAAGCACCAGCGCCAAATAATAGCTACTATTCAGGGTGAAAAATCATGA
Gene >OphauB2|5666
ATGTCCTGGTTTCAGAAGCAGTTCTCTCTCACCTCTAGGTCTCGTGGATCTTATCTAGTCACTGATCAGATTCTC
ACTGCTCTGCCTGAGATTCGTGAATACAAGATTGGCTTGCTCAACCTCTTTGTGCAGCACACCAGCTGTGCTCTC
AGCCTAAATGAGAACTGTACGTCCCATTTGTTGACTTAATCTCTACTATGTATTTGGCTTGATTTGTTCTTGTAT
CTGATTAAGCGTTCTAGTTGATCAAGATGTCAGAGCAGACATGAGTGACGCGCTGGATCGAATCGCACCAGATCA
AGGTCCCAAGGGAGAGCAGCTTTATCGTCACGAGTAAGCCAACCTCATCTGGGCATATAGTTGGACCTTGGTAAC
CCAGAATTTTGCCACCAGTGCTGAAGGGCCTGACGACATGCCAGTAAGGGTTTCCTCGCTGGGTTCAATCAAAGT
TAGAATACTGACGTTCTTGCGCAGGCACACATCAAGTCAGCCTTGATTGGTGCTAGCGTCACGATTCCAATCAAG
GACGGGAAGTTGGTAGGTTCTCTCTTTTGAACATGTCATGGATACATGGCAAGACTGACTAACAGTTCAAAGGCC
ACAGGCACTTGGCAGGGCATCTGGTATCTCGAGTTTAGGGCAAGCAAGCACCAGCGCCAAATAATAGCTACTATT
CAGGGTGAAAAATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail