Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|566
Gene name
LocationContig_11:105457..108661
Strand-
Gene length (bp)3204
Transcript length (bp)3204
Coding sequence length (bp)3204
Protein length (aa) 1068

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 1.3E-11 274 353
PF19316 PIGO_PIGG GPI ethanolamine phosphate transferase membrane region 1.6E-08 913 1048

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 36 1044 9.0E-179
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 29 1050 2.0E-162
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 69 1051 4.0E-141
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 75 531 5.0E-95
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 75 515 6.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 36 1044 9.0E-179
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 29 1050 2.0E-162
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 69 1051 4.0E-141
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 75 531 5.0E-95
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 75 515 6.0E-92
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 67 425 5.0E-52
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 70 425 2.0E-49
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 70 425 4.0E-49
sp|Q6CLN2|GPI7_KLULA GPI ethanolamine phosphate transferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAS21 PE=3 SV=1 82 425 4.0E-47
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 82 454 3.0E-46
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 81 425 6.0E-46
sp|Q09782|GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=las21 PE=3 SV=1 128 444 6.0E-45
sp|Q758B8|GPI7_ASHGO GPI ethanolamine phosphate transferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LAS21 PE=3 SV=2 79 432 2.0E-44
sp|P40367|GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAS21 PE=1 SV=1 129 425 1.0E-40
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 128 535 1.0E-39
sp|Q6FPB2|GPI7_CANGA GPI ethanolamine phosphate transferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LAS21 PE=3 SV=1 79 425 1.0E-38
sp|Q6C0Z3|MCD4_YARLI GPI ethanolamine phosphate transferase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCD4 PE=3 SV=1 274 452 1.0E-07
sp|Q9R1S3|PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus GN=Pign PE=2 SV=2 264 420 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 515 534 19
3 577 599 22
4 604 626 22
5 638 656 18
6 666 685 19
7 692 710 18
8 736 758 22
9 767 789 22
10 814 836 22
11 849 871 22
12 953 975 22
13 995 1017 22
14 1030 1052 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|566
MAPESPRPAKAAETSSQHKSISEEWKQAKQAKEAQDAEAARLGLPTQKEGDKLRQRLNEQRQAAYERRWRWAVAF
WIWLLIMHVVGLWIFTRGFLLSRLVLEDKSSCGAPPAESKLAPLSIEAGCWHPKTFDRAVVIIIDALRYDFTIPS
SAARSMGHGEPGRAFGDAFPFLYETAVAQPQNAFLRPFIADPPTTTLQRLKGLTTGTLPTFVDAGSNFAGTAIEE
DNLLAQLRAEGKKIAHVGDDTWWALFPGYFEANISRAYDSFNVWDLHSVDNGVMDNMMPLLDDAQSKGQWDVLIG
HCLGVDHAGHRYGPDHVAMNAKLSQMDDFVRRLVGRIGEDTLLIVMGDHGMDAKGDHGGESDDEVEAALWMYSKR
PLFGRTRPEDARPPLTAKERPTNQIDLVPTLALLLGIPIPFNNLGRPIEEAFAGALGSDWANLAAVSRMASAGIE
RYQRAYFAARGMSPDSGPGSPAQLWTRANGEGQSAEEAYRAFARFQEETLRVCKGLWARFDVPRMAAGVCIAAAG
LVLLLMYASRRPDDAYVVVNDVELDYAERRLELSEAKRATRVHADQWQHKELLGGMLNVRFVLVTLPLVATAVWR
RHPLDALAGLLVVLTMATVSTQLQAAGKRLANVAPRGFWGWLAVGLGASQCIGFASNSYTVWEDGIVLFLLSTFG
LAAAVAAFGIEAKAERALALYHALAFVVLGRLASYSKLCREEQMPYCTSTYYASAASSTSAPWQLAIPFVVLGVL
PSIIKSFLTPTASYHGLAPLWIGYVLRASLGLSAVYWVIDAADNGNWLASSTLLPDGALKALGVYTAQLGLALAL
VAGTTAYVWAPPCVSVVSAGRARVVVLGYANALGARYLLLPLNVLSACLVLSKPMGGGALALMLWQVLSLAETTH
RLGLKTEPIGPVVMALLGMHYFFKTGHQASLASIQWDSAFIPLFSVRYPWSPLAVLLNTFAGPILAAACLPLLTL
WRTGPRQRGGASLEVVARAAAVFVGVYAAQALASMACAAWLRRHLMLFRVFSPRFLLAGVLLLLMDVVLVVVVFA
GLRTNALAVGEVFGWPE*
Coding >OphauB2|566
ATGGCGCCCGAGAGTCCGCGGCCGGCAAAGGCAGCAGAGACGAGCAGCCAACACAAGAGCATTTCGGAAGAATGG
AAACAGGCCAAGCAAGCCAAAGAGGCGCAAGATGCCGAAGCAGCACGGCTAGGACTCCCGACACAAAAAGAAGGC
GACAAGCTGCGACAGAGACTCAATGAGCAACGACAGGCGGCCTATGAGCGCCGCTGGCGGTGGGCAGTGGCCTTT
TGGATATGGCTGCTCATTATGCACGTTGTTGGACTCTGGATATTCACCAGGGGCTTTCTCCTGAGCCGGCTTGTT
CTCGAGGACAAGTCGAGCTGTGGCGCACCGCCGGCAGAGAGCAAGCTGGCGCCACTGAGCATTGAGGCTGGCTGC
TGGCATCCCAAGACGTTTGACCGCGCCGTGGTGATTATCATTGATGCCCTGCGCTACGACTTTACGATTCCTAGC
AGCGCTGCACGCAGCATGGGCCACGGGGAGCCGGGGCGGGCGTTTGGCGATGCGTTTCCCTTTTTGTACGAGACG
GCAGTGGCGCAGCCGCAAAACGCCTTTTTGCGGCCCTTTATCGCCGACCCGCCCACCACGACATTACAGCGGCTC
AAGGGCCTGACGACGGGCACGCTGCCCACCTTTGTCGATGCGGGGAGCAACTTTGCCGGGACTGCGATTGAGGAG
GACAATTTACTGGCGCAGCTGAGGGCCGAGGGCAAAAAGATTGCACATGTTGGCGATGATACGTGGTGGGCTTTG
TTCCCCGGCTACTTTGAGGCCAACATCTCGCGGGCCTATGACAGCTTCAACGTGTGGGATCTGCATAGCGTTGAC
AATGGAGTCATGGACAACATGATGCCCTTGCTGGATGACGCGCAGAGCAAAGGCCAGTGGGATGTACTGATTGGA
CATTGTCTGGGAGTGGATCACGCAGGCCATCGCTACGGCCCCGACCATGTGGCCATGAATGCCAAACTGAGCCAG
ATGGATGACTTTGTGCGCAGGCTGGTGGGCAGGATTGGCGAGGATACGCTGCTCATTGTCATGGGCGACCATGGC
ATGGACGCCAAGGGCGACCACGGCGGCGAGAGCGACGACGAGGTGGAAGCAGCGCTCTGGATGTACTCGAAGCGG
CCCCTCTTTGGACGCACGCGGCCCGAGGATGCGCGTCCGCCATTGACAGCCAAGGAGCGGCCCACCAACCAGATT
GACCTGGTGCCCACGCTGGCCTTGCTTCTCGGCATTCCGATTCCCTTTAACAACCTGGGCCGGCCGATTGAGGAG
GCGTTTGCGGGAGCGCTGGGAAGCGATTGGGCCAACCTGGCGGCCGTGTCGCGCATGGCGTCTGCCGGCATCGAG
CGCTACCAAAGGGCGTACTTTGCAGCGCGAGGCATGTCGCCCGACTCGGGGCCCGGCTCTCCAGCGCAGCTGTGG
ACAAGAGCCAATGGCGAGGGCCAGTCAGCCGAGGAGGCATACAGGGCCTTTGCGCGCTTCCAGGAGGAGACGCTG
CGAGTGTGCAAGGGCCTATGGGCGCGCTTCGACGTGCCGCGCATGGCTGCCGGCGTCTGCATCGCAGCGGCGGGC
CTGGTGCTGCTGCTCATGTACGCGTCGCGACGCCCCGACGACGCATACGTGGTGGTTAATGACGTGGAACTCGAC
TATGCAGAACGGAGGCTTGAGCTAAGCGAGGCCAAGAGGGCAACGAGGGTGCATGCCGACCAGTGGCAGCACAAG
GAGCTGCTGGGCGGCATGCTCAATGTGCGCTTCGTGCTGGTGACGCTGCCGCTGGTGGCGACGGCGGTGTGGCGG
CGGCACCCCCTCGACGCGCTGGCGGGCTTGCTAGTGGTGCTGACCATGGCAACGGTGAGCACGCAGCTGCAGGCC
GCGGGCAAGAGGCTGGCCAATGTGGCGCCGCGCGGCTTCTGGGGCTGGCTGGCGGTGGGCCTGGGCGCGAGCCAG
TGCATTGGCTTTGCCTCGAATTCGTACACGGTGTGGGAGGACGGCATAGTGCTCTTTTTGCTCTCCACCTTTGGC
CTGGCGGCAGCAGTGGCGGCGTTTGGCATCGAGGCCAAGGCGGAGCGTGCACTGGCTCTTTACCATGCCCTGGCC
TTTGTCGTGCTGGGCCGGCTGGCCTCGTACTCGAAGCTGTGTCGCGAGGAGCAGATGCCCTACTGCACATCGACC
TACTACGCCTCGGCCGCGTCGTCCACCTCTGCGCCGTGGCAGCTTGCCATTCCCTTTGTGGTGCTGGGCGTCTTG
CCGAGCATCATCAAGTCCTTCTTGACGCCCACGGCCTCGTATCACGGCCTGGCGCCCCTGTGGATTGGCTACGTG
CTGCGCGCCAGCCTCGGGCTCTCGGCCGTGTACTGGGTCATTGACGCGGCAGATAATGGCAACTGGCTCGCCTCC
TCCACCTTGTTGCCCGACGGCGCGCTCAAGGCGCTGGGCGTGTATACCGCGCAGCTGGGCCTGGCGCTGGCGCTG
GTTGCCGGAACAACGGCCTATGTCTGGGCGCCGCCCTGCGTCAGCGTCGTGTCGGCGGGGCGCGCGCGCGTCGTG
GTGCTGGGCTATGCCAATGCTCTGGGCGCGCGCTATCTCCTCTTGCCGCTCAATGTGCTGAGCGCATGCCTCGTC
CTTTCCAAGCCCATGGGCGGCGGCGCGCTGGCCCTGATGCTCTGGCAAGTCTTGTCTCTGGCGGAAACGACGCAC
CGCCTCGGCCTCAAGACGGAACCCATTGGCCCCGTCGTCATGGCCCTGCTGGGAATGCATTATTTCTTTAAAACG
GGCCATCAGGCTTCCCTGGCCAGCATCCAGTGGGACAGCGCCTTTATCCCCCTCTTTTCCGTGCGCTATCCTTGG
TCTCCGCTCGCCGTGCTGCTCAATACGTTTGCCGGGCCCATCTTGGCAGCTGCCTGTCTGCCACTCCTGACGCTT
TGGCGAACTGGCCCGCGCCAACGCGGCGGCGCCTCTCTTGAAGTGGTGGCGCGCGCGGCGGCTGTCTTTGTGGGC
GTGTATGCCGCGCAGGCGCTGGCGTCCATGGCGTGTGCGGCCTGGCTGCGCAGACACCTCATGCTCTTTCGCGTC
TTTAGCCCGCGCTTCTTGCTGGCGGGCGTGCTGCTGCTGCTCATGGACGTGGTGCTTGTCGTGGTGGTGTTTGCC
GGCCTGCGCACCAATGCGCTTGCAGTGGGAGAGGTATTTGGATGGCCCGAGTAA
Transcript >OphauB2|566
ATGGCGCCCGAGAGTCCGCGGCCGGCAAAGGCAGCAGAGACGAGCAGCCAACACAAGAGCATTTCGGAAGAATGG
AAACAGGCCAAGCAAGCCAAAGAGGCGCAAGATGCCGAAGCAGCACGGCTAGGACTCCCGACACAAAAAGAAGGC
GACAAGCTGCGACAGAGACTCAATGAGCAACGACAGGCGGCCTATGAGCGCCGCTGGCGGTGGGCAGTGGCCTTT
TGGATATGGCTGCTCATTATGCACGTTGTTGGACTCTGGATATTCACCAGGGGCTTTCTCCTGAGCCGGCTTGTT
CTCGAGGACAAGTCGAGCTGTGGCGCACCGCCGGCAGAGAGCAAGCTGGCGCCACTGAGCATTGAGGCTGGCTGC
TGGCATCCCAAGACGTTTGACCGCGCCGTGGTGATTATCATTGATGCCCTGCGCTACGACTTTACGATTCCTAGC
AGCGCTGCACGCAGCATGGGCCACGGGGAGCCGGGGCGGGCGTTTGGCGATGCGTTTCCCTTTTTGTACGAGACG
GCAGTGGCGCAGCCGCAAAACGCCTTTTTGCGGCCCTTTATCGCCGACCCGCCCACCACGACATTACAGCGGCTC
AAGGGCCTGACGACGGGCACGCTGCCCACCTTTGTCGATGCGGGGAGCAACTTTGCCGGGACTGCGATTGAGGAG
GACAATTTACTGGCGCAGCTGAGGGCCGAGGGCAAAAAGATTGCACATGTTGGCGATGATACGTGGTGGGCTTTG
TTCCCCGGCTACTTTGAGGCCAACATCTCGCGGGCCTATGACAGCTTCAACGTGTGGGATCTGCATAGCGTTGAC
AATGGAGTCATGGACAACATGATGCCCTTGCTGGATGACGCGCAGAGCAAAGGCCAGTGGGATGTACTGATTGGA
CATTGTCTGGGAGTGGATCACGCAGGCCATCGCTACGGCCCCGACCATGTGGCCATGAATGCCAAACTGAGCCAG
ATGGATGACTTTGTGCGCAGGCTGGTGGGCAGGATTGGCGAGGATACGCTGCTCATTGTCATGGGCGACCATGGC
ATGGACGCCAAGGGCGACCACGGCGGCGAGAGCGACGACGAGGTGGAAGCAGCGCTCTGGATGTACTCGAAGCGG
CCCCTCTTTGGACGCACGCGGCCCGAGGATGCGCGTCCGCCATTGACAGCCAAGGAGCGGCCCACCAACCAGATT
GACCTGGTGCCCACGCTGGCCTTGCTTCTCGGCATTCCGATTCCCTTTAACAACCTGGGCCGGCCGATTGAGGAG
GCGTTTGCGGGAGCGCTGGGAAGCGATTGGGCCAACCTGGCGGCCGTGTCGCGCATGGCGTCTGCCGGCATCGAG
CGCTACCAAAGGGCGTACTTTGCAGCGCGAGGCATGTCGCCCGACTCGGGGCCCGGCTCTCCAGCGCAGCTGTGG
ACAAGAGCCAATGGCGAGGGCCAGTCAGCCGAGGAGGCATACAGGGCCTTTGCGCGCTTCCAGGAGGAGACGCTG
CGAGTGTGCAAGGGCCTATGGGCGCGCTTCGACGTGCCGCGCATGGCTGCCGGCGTCTGCATCGCAGCGGCGGGC
CTGGTGCTGCTGCTCATGTACGCGTCGCGACGCCCCGACGACGCATACGTGGTGGTTAATGACGTGGAACTCGAC
TATGCAGAACGGAGGCTTGAGCTAAGCGAGGCCAAGAGGGCAACGAGGGTGCATGCCGACCAGTGGCAGCACAAG
GAGCTGCTGGGCGGCATGCTCAATGTGCGCTTCGTGCTGGTGACGCTGCCGCTGGTGGCGACGGCGGTGTGGCGG
CGGCACCCCCTCGACGCGCTGGCGGGCTTGCTAGTGGTGCTGACCATGGCAACGGTGAGCACGCAGCTGCAGGCC
GCGGGCAAGAGGCTGGCCAATGTGGCGCCGCGCGGCTTCTGGGGCTGGCTGGCGGTGGGCCTGGGCGCGAGCCAG
TGCATTGGCTTTGCCTCGAATTCGTACACGGTGTGGGAGGACGGCATAGTGCTCTTTTTGCTCTCCACCTTTGGC
CTGGCGGCAGCAGTGGCGGCGTTTGGCATCGAGGCCAAGGCGGAGCGTGCACTGGCTCTTTACCATGCCCTGGCC
TTTGTCGTGCTGGGCCGGCTGGCCTCGTACTCGAAGCTGTGTCGCGAGGAGCAGATGCCCTACTGCACATCGACC
TACTACGCCTCGGCCGCGTCGTCCACCTCTGCGCCGTGGCAGCTTGCCATTCCCTTTGTGGTGCTGGGCGTCTTG
CCGAGCATCATCAAGTCCTTCTTGACGCCCACGGCCTCGTATCACGGCCTGGCGCCCCTGTGGATTGGCTACGTG
CTGCGCGCCAGCCTCGGGCTCTCGGCCGTGTACTGGGTCATTGACGCGGCAGATAATGGCAACTGGCTCGCCTCC
TCCACCTTGTTGCCCGACGGCGCGCTCAAGGCGCTGGGCGTGTATACCGCGCAGCTGGGCCTGGCGCTGGCGCTG
GTTGCCGGAACAACGGCCTATGTCTGGGCGCCGCCCTGCGTCAGCGTCGTGTCGGCGGGGCGCGCGCGCGTCGTG
GTGCTGGGCTATGCCAATGCTCTGGGCGCGCGCTATCTCCTCTTGCCGCTCAATGTGCTGAGCGCATGCCTCGTC
CTTTCCAAGCCCATGGGCGGCGGCGCGCTGGCCCTGATGCTCTGGCAAGTCTTGTCTCTGGCGGAAACGACGCAC
CGCCTCGGCCTCAAGACGGAACCCATTGGCCCCGTCGTCATGGCCCTGCTGGGAATGCATTATTTCTTTAAAACG
GGCCATCAGGCTTCCCTGGCCAGCATCCAGTGGGACAGCGCCTTTATCCCCCTCTTTTCCGTGCGCTATCCTTGG
TCTCCGCTCGCCGTGCTGCTCAATACGTTTGCCGGGCCCATCTTGGCAGCTGCCTGTCTGCCACTCCTGACGCTT
TGGCGAACTGGCCCGCGCCAACGCGGCGGCGCCTCTCTTGAAGTGGTGGCGCGCGCGGCGGCTGTCTTTGTGGGC
GTGTATGCCGCGCAGGCGCTGGCGTCCATGGCGTGTGCGGCCTGGCTGCGCAGACACCTCATGCTCTTTCGCGTC
TTTAGCCCGCGCTTCTTGCTGGCGGGCGTGCTGCTGCTGCTCATGGACGTGGTGCTTGTCGTGGTGGTGTTTGCC
GGCCTGCGCACCAATGCGCTTGCAGTGGGAGAGGTATTTGGATGGCCCGAGTAA
Gene >OphauB2|566
ATGGCGCCCGAGAGTCCGCGGCCGGCAAAGGCAGCAGAGACGAGCAGCCAACACAAGAGCATTTCGGAAGAATGG
AAACAGGCCAAGCAAGCCAAAGAGGCGCAAGATGCCGAAGCAGCACGGCTAGGACTCCCGACACAAAAAGAAGGC
GACAAGCTGCGACAGAGACTCAATGAGCAACGACAGGCGGCCTATGAGCGCCGCTGGCGGTGGGCAGTGGCCTTT
TGGATATGGCTGCTCATTATGCACGTTGTTGGACTCTGGATATTCACCAGGGGCTTTCTCCTGAGCCGGCTTGTT
CTCGAGGACAAGTCGAGCTGTGGCGCACCGCCGGCAGAGAGCAAGCTGGCGCCACTGAGCATTGAGGCTGGCTGC
TGGCATCCCAAGACGTTTGACCGCGCCGTGGTGATTATCATTGATGCCCTGCGCTACGACTTTACGATTCCTAGC
AGCGCTGCACGCAGCATGGGCCACGGGGAGCCGGGGCGGGCGTTTGGCGATGCGTTTCCCTTTTTGTACGAGACG
GCAGTGGCGCAGCCGCAAAACGCCTTTTTGCGGCCCTTTATCGCCGACCCGCCCACCACGACATTACAGCGGCTC
AAGGGCCTGACGACGGGCACGCTGCCCACCTTTGTCGATGCGGGGAGCAACTTTGCCGGGACTGCGATTGAGGAG
GACAATTTACTGGCGCAGCTGAGGGCCGAGGGCAAAAAGATTGCACATGTTGGCGATGATACGTGGTGGGCTTTG
TTCCCCGGCTACTTTGAGGCCAACATCTCGCGGGCCTATGACAGCTTCAACGTGTGGGATCTGCATAGCGTTGAC
AATGGAGTCATGGACAACATGATGCCCTTGCTGGATGACGCGCAGAGCAAAGGCCAGTGGGATGTACTGATTGGA
CATTGTCTGGGAGTGGATCACGCAGGCCATCGCTACGGCCCCGACCATGTGGCCATGAATGCCAAACTGAGCCAG
ATGGATGACTTTGTGCGCAGGCTGGTGGGCAGGATTGGCGAGGATACGCTGCTCATTGTCATGGGCGACCATGGC
ATGGACGCCAAGGGCGACCACGGCGGCGAGAGCGACGACGAGGTGGAAGCAGCGCTCTGGATGTACTCGAAGCGG
CCCCTCTTTGGACGCACGCGGCCCGAGGATGCGCGTCCGCCATTGACAGCCAAGGAGCGGCCCACCAACCAGATT
GACCTGGTGCCCACGCTGGCCTTGCTTCTCGGCATTCCGATTCCCTTTAACAACCTGGGCCGGCCGATTGAGGAG
GCGTTTGCGGGAGCGCTGGGAAGCGATTGGGCCAACCTGGCGGCCGTGTCGCGCATGGCGTCTGCCGGCATCGAG
CGCTACCAAAGGGCGTACTTTGCAGCGCGAGGCATGTCGCCCGACTCGGGGCCCGGCTCTCCAGCGCAGCTGTGG
ACAAGAGCCAATGGCGAGGGCCAGTCAGCCGAGGAGGCATACAGGGCCTTTGCGCGCTTCCAGGAGGAGACGCTG
CGAGTGTGCAAGGGCCTATGGGCGCGCTTCGACGTGCCGCGCATGGCTGCCGGCGTCTGCATCGCAGCGGCGGGC
CTGGTGCTGCTGCTCATGTACGCGTCGCGACGCCCCGACGACGCATACGTGGTGGTTAATGACGTGGAACTCGAC
TATGCAGAACGGAGGCTTGAGCTAAGCGAGGCCAAGAGGGCAACGAGGGTGCATGCCGACCAGTGGCAGCACAAG
GAGCTGCTGGGCGGCATGCTCAATGTGCGCTTCGTGCTGGTGACGCTGCCGCTGGTGGCGACGGCGGTGTGGCGG
CGGCACCCCCTCGACGCGCTGGCGGGCTTGCTAGTGGTGCTGACCATGGCAACGGTGAGCACGCAGCTGCAGGCC
GCGGGCAAGAGGCTGGCCAATGTGGCGCCGCGCGGCTTCTGGGGCTGGCTGGCGGTGGGCCTGGGCGCGAGCCAG
TGCATTGGCTTTGCCTCGAATTCGTACACGGTGTGGGAGGACGGCATAGTGCTCTTTTTGCTCTCCACCTTTGGC
CTGGCGGCAGCAGTGGCGGCGTTTGGCATCGAGGCCAAGGCGGAGCGTGCACTGGCTCTTTACCATGCCCTGGCC
TTTGTCGTGCTGGGCCGGCTGGCCTCGTACTCGAAGCTGTGTCGCGAGGAGCAGATGCCCTACTGCACATCGACC
TACTACGCCTCGGCCGCGTCGTCCACCTCTGCGCCGTGGCAGCTTGCCATTCCCTTTGTGGTGCTGGGCGTCTTG
CCGAGCATCATCAAGTCCTTCTTGACGCCCACGGCCTCGTATCACGGCCTGGCGCCCCTGTGGATTGGCTACGTG
CTGCGCGCCAGCCTCGGGCTCTCGGCCGTGTACTGGGTCATTGACGCGGCAGATAATGGCAACTGGCTCGCCTCC
TCCACCTTGTTGCCCGACGGCGCGCTCAAGGCGCTGGGCGTGTATACCGCGCAGCTGGGCCTGGCGCTGGCGCTG
GTTGCCGGAACAACGGCCTATGTCTGGGCGCCGCCCTGCGTCAGCGTCGTGTCGGCGGGGCGCGCGCGCGTCGTG
GTGCTGGGCTATGCCAATGCTCTGGGCGCGCGCTATCTCCTCTTGCCGCTCAATGTGCTGAGCGCATGCCTCGTC
CTTTCCAAGCCCATGGGCGGCGGCGCGCTGGCCCTGATGCTCTGGCAAGTCTTGTCTCTGGCGGAAACGACGCAC
CGCCTCGGCCTCAAGACGGAACCCATTGGCCCCGTCGTCATGGCCCTGCTGGGAATGCATTATTTCTTTAAAACG
GGCCATCAGGCTTCCCTGGCCAGCATCCAGTGGGACAGCGCCTTTATCCCCCTCTTTTCCGTGCGCTATCCTTGG
TCTCCGCTCGCCGTGCTGCTCAATACGTTTGCCGGGCCCATCTTGGCAGCTGCCTGTCTGCCACTCCTGACGCTT
TGGCGAACTGGCCCGCGCCAACGCGGCGGCGCCTCTCTTGAAGTGGTGGCGCGCGCGGCGGCTGTCTTTGTGGGC
GTGTATGCCGCGCAGGCGCTGGCGTCCATGGCGTGTGCGGCCTGGCTGCGCAGACACCTCATGCTCTTTCGCGTC
TTTAGCCCGCGCTTCTTGCTGGCGGGCGTGCTGCTGCTGCTCATGGACGTGGTGCTTGTCGTGGTGGTGTTTGCC
GGCCTGCGCACCAATGCGCTTGCAGTGGGAGAGGTATTTGGATGGCCCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail