Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5659
Gene name
LocationContig_457:330..976
Strand+
Gene length (bp)646
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 3.2E-15 53 145
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 7.8E-09 87 149
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 1.4E-08 68 145
PF08445 FR47 FR47-like protein 2.1E-08 88 148
PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain 1.1E-06 55 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74311|NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa30 PE=3 SV=1 24 166 9.0E-45
sp|Q147X3|NAA30_HUMAN N-alpha-acetyltransferase 30 OS=Homo sapiens GN=NAA30 PE=1 SV=1 12 169 2.0E-43
sp|Q8CES0|NAA30_MOUSE N-alpha-acetyltransferase 30 OS=Mus musculus GN=Naa30 PE=1 SV=2 12 169 3.0E-43
sp|O80438|MAK3_ARATH N-alpha-acetyltransferase MAK3 OS=Arabidopsis thaliana GN=MAK3 PE=2 SV=1 25 191 9.0E-43
sp|Q0IHH1|NAA30_XENLA N-alpha-acetyltransferase 30 OS=Xenopus laevis GN=naa30 PE=2 SV=1 29 169 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74311|NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa30 PE=3 SV=1 24 166 9.0E-45
sp|Q147X3|NAA30_HUMAN N-alpha-acetyltransferase 30 OS=Homo sapiens GN=NAA30 PE=1 SV=1 12 169 2.0E-43
sp|Q8CES0|NAA30_MOUSE N-alpha-acetyltransferase 30 OS=Mus musculus GN=Naa30 PE=1 SV=2 12 169 3.0E-43
sp|O80438|MAK3_ARATH N-alpha-acetyltransferase MAK3 OS=Arabidopsis thaliana GN=MAK3 PE=2 SV=1 25 191 9.0E-43
sp|Q0IHH1|NAA30_XENLA N-alpha-acetyltransferase 30 OS=Xenopus laevis GN=naa30 PE=2 SV=1 29 169 2.0E-42
sp|Q03503|NAA30_YEAST N-alpha-acetyltransferase 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK3 PE=1 SV=1 28 177 5.0E-42
sp|Q95RC0|NAA30_DROME N-alpha-acetyltransferase 30 OS=Drosophila melanogaster GN=CG11412 PE=2 SV=1 29 166 2.0E-39
sp|Q54MP9|NAA30_DICDI N-alpha-acetyltransferase 30 OS=Dictyostelium discoideum GN=DDB_G0285803 PE=3 SV=1 31 168 9.0E-35
sp|Q976C3|Y258_SULTO Uncharacterized N-acetyltransferase STK_02580 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02580 PE=3 SV=1 37 168 1.0E-15
sp|Q4JBG0|Y459_SULAC Uncharacterized N-acetyltransferase Saci_0459 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0459 PE=3 SV=1 37 168 4.0E-14
sp|Q980R9|Y209_SULSO Uncharacterized N-acetyltransferase SSO0209 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0209 PE=1 SV=2 37 168 5.0E-14
sp|P36416|ARD1_DICDI N-terminal acetyltransferase complex ARD1 subunit homolog OS=Dictyostelium discoideum GN=natA PE=2 SV=1 37 168 4.0E-07
sp|O61219|DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans GN=daf-31 PE=2 SV=1 37 162 4.0E-07
sp|P41227|NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens GN=NAA10 PE=1 SV=1 37 171 5.0E-07
sp|Q9QY36|NAA10_MOUSE N-alpha-acetyltransferase 10 OS=Mus musculus GN=Naa10 PE=1 SV=1 37 171 5.0E-07
sp|Q2KI14|NAA10_BOVIN N-alpha-acetyltransferase 10 OS=Bos taurus GN=NAA10 PE=2 SV=1 37 171 5.0E-07
sp|Q9UTI3|ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ard1 PE=1 SV=1 36 175 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0003824 catalytic activity No
GO:0016407 acetyltransferase activity No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016410 N-acyltransferase activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5659
MALQDMCQLAGLTYQQYNHGLEARYLPAIRSLISKDLSEPYSIYVYRYFLCQWAHLCFMALDPVDLSLIGVIVCK
LEVHSSHSPPTKRGYIAMLAVAAPFRGHGVATALVQRSIKAMAAQQADEVVLETEESNASAMRLYQRLGFLRSKK
LHRYYLNGNSAYRLVLPLKSLNQDACSNYIYNDIALDTLPRG*
Coding >OphauB2|5659
ATGGCCCTACAAGACATGTGCCAGTTAGCAGGACTTACCTATCAGCAATACAACCACGGACTAGAGGCACGCTAT
CTACCAGCCATACGATCTCTTATTTCCAAAGATCTAAGCGAGCCATATAGCATCTACGTCTACCGGTACTTTCTC
TGCCAGTGGGCTCACCTCTGCTTCATGGCACTCGACCCTGTTGATTTATCCCTTATTGGTGTCATTGTCTGCAAG
CTCGAGGTTCACTCATCTCACTCCCCGCCTACCAAGCGCGGGTACATAGCTATGCTTGCTGTTGCCGCTCCTTTT
CGCGGCCACGGCGTCGCCACTGCCCTGGTTCAAAGATCCATCAAGGCAATGGCAGCTCAACAGGCAGACGAGGTT
GTTCTAGAGACTGAAGAGTCCAACGCTTCGGCAATGAGGCTATACCAGCGCCTAGGCTTCCTTCGATCCAAAAAG
CTACATCGATATTACCTCAATGGCAACAGTGCCTACCGTCTCGTCCTACCCCTCAAGTCCTTGAACCAAGACGCA
TGCTCAAATTACATCTACAACGACATTGCCCTCGATACATTGCCACGAGGCTAG
Transcript >OphauB2|5659
ATGGCCCTACAAGACATGTGCCAGTTAGCAGGACTTACCTATCAGCAATACAACCACGGACTAGAGGCACGCTAT
CTACCAGCCATACGATCTCTTATTTCCAAAGATCTAAGCGAGCCATATAGCATCTACGTCTACCGGTACTTTCTC
TGCCAGTGGGCTCACCTCTGCTTCATGGCACTCGACCCTGTTGATTTATCCCTTATTGGTGTCATTGTCTGCAAG
CTCGAGGTTCACTCATCTCACTCCCCGCCTACCAAGCGCGGGTACATAGCTATGCTTGCTGTTGCCGCTCCTTTT
CGCGGCCACGGCGTCGCCACTGCCCTGGTTCAAAGATCCATCAAGGCAATGGCAGCTCAACAGGCAGACGAGGTT
GTTCTAGAGACTGAAGAGTCCAACGCTTCGGCAATGAGGCTATACCAGCGCCTAGGCTTCCTTCGATCCAAAAAG
CTACATCGATATTACCTCAATGGCAACAGTGCCTACCGTCTCGTCCTACCCCTCAAGTCCTTGAACCAAGACGCA
TGCTCAAATTACATCTACAACGACATTGCCCTCGATACATTGCCACGAGGCTAG
Gene >OphauB2|5659
ATGGCCCTACAAGACATGTGCCAGTTAGCAGGACTTACCTATCAGCAATACAACCACGGACTAGAGGCACGCTAT
CTACCAGCCATACGATCTCTTATTTCCAAAGATCTAAGCGAGCCATATAGCATCTACGTCTACCGGTACTTTCTC
TGCCAGTGGGCTCACCTCTGCTTCATGGTTGGCTTCTTGGCCCTATACTTGGCTTCCCGCCATTTCCCGATCCAC
TGACGCTATTGCTCTCTAGGCACTCGACCCTGTTGATTTATCCCTTATTGGTGTCATTGTCTGCAAGCTCGAGGT
TCACTCATCTCACTCCCCGCCTACCAAGCGCGGGTACATAGCTATGCTTGCTGTTGCCGCTCCTTTTCGCGGCCA
CGGCGTCGCCACTGCCCTGGTTCAAAGATCCATCAAGGCAATGGCAGCTCAACAGGCAGACGAGGTTGTTCTAGA
GACTGAAGAGTCCAACGCTTCGGCAATGAGGCTATACCAGCGCCTAGGCTTCCTTCGATCCAAAAAGCTACATCG
ATATTACCTCAATGGCAACAGTGCCTACCGTCTCGTCCTACCCCTCAAGTCCTTGAACCAAGACGCATGCTCAAA
TTACATCTACAACGACATTGCCCTCGATACATTGCCACGAGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail