Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5656
Gene name
LocationContig_452:415..1738
Strand+
Gene length (bp)1323
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12588 PSDC Phophatidylserine decarboxylase 3.4E-48 1 117
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 5.1E-37 150 352

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 145 353 3.0E-24
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 146 347 1.0E-20
sp|Q5JN42|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 49 347 3.0E-19
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 146 347 4.0E-18
sp|A8MJ83|PSD_ALKOO Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 146 347 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 145 353 3.0E-24
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 146 347 1.0E-20
sp|Q5JN42|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 49 347 3.0E-19
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 146 347 4.0E-18
sp|A8MJ83|PSD_ALKOO Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 146 347 2.0E-17
sp|A9VHW5|PSD_BACWK Phosphatidylserine decarboxylase proenzyme OS=Bacillus weihenstephanensis (strain KBAB4) GN=psd PE=3 SV=1 136 347 5.0E-17
sp|A0Q3R9|PSD_CLONN Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 136 361 1.0E-15
sp|C1ESN2|PSD_BACC3 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain 03BB102) GN=psd PE=3 SV=1 146 347 1.0E-15
sp|A0RIV4|PSD_BACAH Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis (strain Al Hakam) GN=psd PE=3 SV=1 146 347 1.0E-15
sp|Q6HDI5|PSD_BACHK Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=psd PE=3 SV=1 146 347 2.0E-15
sp|Q730J7|PSD_BACC1 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=psd PE=3 SV=2 146 347 2.0E-15
sp|Q9PLM7|PSD_CHLMU Phosphatidylserine decarboxylase proenzyme OS=Chlamydia muridarum (strain MoPn / Nigg) GN=psd PE=3 SV=1 146 345 2.0E-15
sp|Q634K5|PSD_BACCZ Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ZK / E33L) GN=psd PE=3 SV=1 146 347 2.0E-15
sp|Q81LP7|PSD_BACAN Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis GN=psd PE=3 SV=1 146 347 3.0E-15
sp|C3L5U2|PSD_BACAC Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=psd PE=3 SV=1 146 347 3.0E-15
sp|C3P929|PSD_BACAA Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain A0248) GN=psd PE=3 SV=1 146 347 3.0E-15
sp|B7HPN7|PSD_BACC7 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH187) GN=psd PE=3 SV=1 146 347 3.0E-15
sp|B7JNX0|PSD_BACC0 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH820) GN=psd PE=3 SV=1 146 347 3.0E-15
sp|B7IYJ1|PSD_BACC2 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain G9842) GN=psd PE=3 SV=1 146 347 3.0E-15
sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 146 362 4.0E-15
sp|Q818C6|PSD_BACCR Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=psd PE=3 SV=1 146 347 6.0E-15
sp|B7HCW5|PSD_BACC4 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain B4264) GN=psd PE=3 SV=1 146 347 6.0E-15
sp|Q9Z767|PSD_CHLPN Phosphatidylserine decarboxylase proenzyme OS=Chlamydia pneumoniae GN=psd PE=3 SV=1 86 345 1.0E-14
sp|Q97N08|PSD1_CLOAB Phosphatidylserine decarboxylase proenzyme 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=psd1 PE=3 SV=1 145 347 2.0E-14
sp|B8I6U9|PSD_CLOCE Phosphatidylserine decarboxylase proenzyme OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=psd PE=3 SV=1 136 353 2.0E-14
sp|P0CD79|PSD_CHLTR Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=psd PE=3 SV=1 146 353 2.0E-14
sp|Q3KKZ5|PSD_CHLTA Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=psd PE=3 SV=1 146 353 2.0E-14
sp|B0B8S5|PSD_CHLT2 Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=psd PE=3 SV=1 146 353 2.0E-14
sp|B0BAF4|PSD_CHLTB Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=psd PE=3 SV=1 146 353 2.0E-14
sp|Q899T7|PSD_CLOTE Phosphatidylserine decarboxylase proenzyme OS=Clostridium tetani (strain Massachusetts / E88) GN=psd PE=3 SV=1 146 371 4.0E-14
sp|C1FPI8|PSD_CLOBJ Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Kyoto / Type A2) GN=psd PE=3 SV=1 146 349 4.0E-14
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 138 254 7.0E-14
sp|A7G9C7|PSD_CLOBL Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=psd PE=3 SV=1 145 353 1.0E-13
sp|A0KSQ8|PSD_SHESA Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain ANA-3) GN=psd PE=3 SV=1 131 347 2.0E-13
sp|Q0HMP8|PSD_SHESM Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-4) GN=psd PE=3 SV=1 131 348 4.0E-13
sp|A7GT32|PSD_BACCN Phosphatidylserine decarboxylase proenzyme OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=psd PE=3 SV=1 136 347 4.0E-13
sp|Q0HR33|PSD_SHESR Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-7) GN=psd PE=3 SV=1 131 347 4.0E-13
sp|C3KXS2|PSD_CLOB6 Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain 657 / Type Ba4) GN=psd PE=3 SV=1 146 349 4.0E-13
sp|A5HXS0|PSD_CLOBH Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=psd PE=3 SV=1 145 348 4.0E-13
sp|A7FQ59|PSD_CLOB1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=psd PE=3 SV=1 145 348 4.0E-13
sp|A4YAL8|PSD_SHEPC Phosphatidylserine decarboxylase proenzyme OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=psd PE=3 SV=1 131 347 5.0E-13
sp|Q0TV39|PSD_CLOP1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=psd PE=3 SV=1 146 347 6.0E-13
sp|Q0SWT6|PSD_CLOPS Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain SM101 / Type A) GN=psd PE=3 SV=1 146 347 9.0E-13
sp|Q8XPD5|PSD_CLOPE Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain 13 / Type A) GN=psd PE=3 SV=1 146 347 1.0E-12
sp|A1RFQ8|PSD_SHESW Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain W3-18-1) GN=psd PE=3 SV=1 131 347 2.0E-12
sp|B1L1M1|PSD_CLOBM Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=psd PE=3 SV=1 149 349 2.0E-12
sp|Q7VYM4|PSD_BORPE Phosphatidylserine decarboxylase proenzyme OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=psd PE=3 SV=1 132 357 3.0E-12
sp|Q7W6I5|PSD_BORPA Phosphatidylserine decarboxylase proenzyme OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=psd PE=3 SV=2 132 357 3.0E-12
sp|Q7WIF7|PSD_BORBR Phosphatidylserine decarboxylase proenzyme OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=psd PE=3 SV=1 132 357 3.0E-12
sp|Q5L4W1|PSD_CHLAB Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=psd PE=3 SV=1 146 345 4.0E-12
sp|Q2L0K8|PSD_BORA1 Phosphatidylserine decarboxylase proenzyme OS=Bordetella avium (strain 197N) GN=psd PE=3 SV=1 132 357 5.0E-12
sp|Q0VMD7|PSD_ALCBS Phosphatidylserine decarboxylase proenzyme OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=psd PE=3 SV=1 146 374 5.0E-12
sp|Q256C9|PSD_CHLFF Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila felis (strain Fe/C-56) GN=psd PE=3 SV=1 146 345 9.0E-12
sp|A3QAD1|PSD_SHELP Phosphatidylserine decarboxylase proenzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=psd PE=3 SV=1 145 352 9.0E-12
sp|B2THF2|PSD_CLOBB Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=psd PE=3 SV=1 146 353 9.0E-12
sp|Q46192|PSD_CLOPA Phosphatidylserine decarboxylase proenzyme OS=Clostridium pasteurianum GN=psd PE=3 SV=1 146 351 1.0E-11
sp|A8H8H5|PSD_SHEPA Phosphatidylserine decarboxylase proenzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=psd PE=3 SV=1 99 347 1.0E-11
sp|B0TU73|PSD_SHEHH Phosphatidylserine decarboxylase proenzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=psd PE=3 SV=1 99 347 1.0E-11
sp|A6LPC8|PSD_CLOB8 Phosphatidylserine decarboxylase proenzyme OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=psd PE=3 SV=1 146 345 1.0E-11
sp|Q5E2C0|PSD_VIBF1 Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=psd PE=3 SV=1 101 353 2.0E-11
sp|Q21H90|PSD_SACD2 Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 106 347 2.0E-11
sp|Q12J86|PSD_SHEDO Phosphatidylserine decarboxylase proenzyme OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=psd PE=3 SV=1 131 258 2.0E-11
sp|B1KHV8|PSD_SHEWM Phosphatidylserine decarboxylase proenzyme OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=psd PE=3 SV=1 145 354 2.0E-11
sp|B5FBS2|PSD_VIBFM Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain MJ11) GN=psd PE=3 SV=1 98 366 2.0E-11
sp|Q83AQ4|PSD_COXBU Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=psd PE=3 SV=1 142 348 3.0E-11
sp|A9NAS0|PSD_COXBR Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=psd PE=3 SV=1 142 348 3.0E-11
sp|B6J316|PSD_COXB2 Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuG_Q212) GN=psd PE=3 SV=1 142 348 3.0E-11
sp|B6J9C5|PSD_COXB1 Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuK_Q154) GN=psd PE=3 SV=1 142 348 3.0E-11
sp|Q2SBA8|PSD_HAHCH Phosphatidylserine decarboxylase proenzyme OS=Hahella chejuensis (strain KCTC 2396) GN=psd PE=3 SV=1 139 260 3.0E-11
sp|Q4FQD5|PSD_PSYA2 Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 145 344 4.0E-11
sp|Q821L3|PSD_CHLCV Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila caviae (strain GPIC) GN=psd PE=3 SV=1 146 345 5.0E-11
sp|A8FRC6|PSD_SHESH Phosphatidylserine decarboxylase proenzyme OS=Shewanella sediminis (strain HAW-EB3) GN=psd PE=3 SV=1 131 347 5.0E-11
sp|A9KEZ8|PSD_COXBN Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain Dugway 5J108-111) GN=psd PE=3 SV=1 142 348 6.0E-11
sp|A9IM91|PSD_BORPD Phosphatidylserine decarboxylase proenzyme OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=psd PE=3 SV=1 138 357 6.0E-11
sp|P53037|PSD2_YEAST Phosphatidylserine decarboxylase proenzyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD2 PE=1 SV=1 146 344 1.0E-10
sp|B0V9W1|PSD_ACIBY Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AYE) GN=psd PE=3 SV=1 131 347 1.0E-10
sp|B2I1N9|PSD_ACIBC Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ACICU) GN=psd PE=3 SV=1 131 347 1.0E-10
sp|B7I242|PSD_ACIB5 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB0057) GN=psd PE=3 SV=1 131 347 1.0E-10
sp|B7GUX2|PSD_ACIB3 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB307-0294) GN=psd PE=3 SV=1 131 347 1.0E-10
sp|A7MZ50|PSD_VIBCB Phosphatidylserine decarboxylase proenzyme OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=psd PE=3 SV=1 128 258 1.0E-10
sp|A3MA23|PSD_ACIBT Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=psd PE=3 SV=2 131 347 1.0E-10
sp|A9L3W8|PSD_SHEB9 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS195) GN=psd PE=3 SV=1 131 347 1.0E-10
sp|A6WSW1|PSD_SHEB8 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS185) GN=psd PE=3 SV=1 131 347 1.0E-10
sp|A3D015|PSD_SHEB5 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=psd PE=3 SV=1 131 347 1.0E-10
sp|B8ECB2|PSD_SHEB2 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS223) GN=psd PE=3 SV=1 131 347 1.0E-10
sp|Q87KZ9|PSD_VIBPA Phosphatidylserine decarboxylase proenzyme OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=psd PE=3 SV=1 131 260 2.0E-10
sp|B6EMR5|PSD_ALISL Phosphatidylserine decarboxylase proenzyme OS=Aliivibrio salmonicida (strain LFI1238) GN=psd PE=3 SV=1 101 258 2.0E-10
sp|Q9HUK8|PSD_PSEAE Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=psd PE=3 SV=1 145 353 2.0E-10
sp|Q1QUI2|PSD_CHRSD Phosphatidylserine decarboxylase proenzyme OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=psd PE=3 SV=1 108 353 2.0E-10
sp|Q0AAC1|PSD_ALKEH Phosphatidylserine decarboxylase proenzyme OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=psd PE=3 SV=1 70 254 3.0E-10
sp|Q1Q8K8|PSD_PSYCK Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 145 344 5.0E-10
sp|C5D4W6|PSD_GEOSW Phosphatidylserine decarboxylase proenzyme OS=Geobacillus sp. (strain WCH70) GN=psd PE=3 SV=1 136 347 5.0E-10
sp|Q1D614|PSD_MYXXD Phosphatidylserine decarboxylase proenzyme OS=Myxococcus xanthus (strain DK 1622) GN=psd PE=3 SV=1 131 353 5.0E-10
sp|Q3IFN3|PSD_PSEHT Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=psd PE=3 SV=2 131 339 6.0E-10
sp|Q02F61|PSD_PSEAB Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=psd PE=3 SV=1 145 353 6.0E-10
sp|B7V346|PSD_PSEA8 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain LESB58) GN=psd PE=3 SV=1 145 353 7.0E-10
sp|Q4KJ87|PSD_PSEF5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=psd PE=3 SV=1 131 346 7.0E-10
sp|A4XPX3|PSD_PSEMY Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas mendocina (strain ymp) GN=psd PE=3 SV=1 146 346 7.0E-10
sp|Q7MGZ5|PSD_VIBVY Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain YJ016) GN=psd PE=3 SV=1 131 260 9.0E-10
sp|Q8DCV8|PSD_VIBVU Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain CMCP6) GN=psd PE=3 SV=1 131 260 9.0E-10
sp|B0VP52|PSD_ACIBS Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain SDF) GN=psd PE=3 SV=1 131 347 1.0E-09
sp|B2UX63|PSD_CLOBA Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=psd PE=3 SV=1 146 347 1.0E-09
sp|Q6LM21|PSD_PHOPR Phosphatidylserine decarboxylase proenzyme OS=Photobacterium profundum GN=psd PE=3 SV=1 138 258 2.0E-09
sp|A6VD70|PSD_PSEA7 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain PA7) GN=psd PE=3 SV=1 145 346 2.0E-09
sp|Q65RD9|PSD_MANSM Phosphatidylserine decarboxylase proenzyme OS=Mannheimia succiniciproducens (strain MBEL55E) GN=psd PE=3 SV=2 146 358 2.0E-09
sp|A4G529|PSD_HERAR Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 137 254 3.0E-09
sp|A1SA30|PSD_SHEAM Phosphatidylserine decarboxylase proenzyme OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=psd PE=3 SV=1 146 354 3.0E-09
sp|A9C3H8|PSD_DELAS Phosphatidylserine decarboxylase proenzyme OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=psd PE=3 SV=1 131 254 3.0E-09
sp|B9MAC0|PSD_ACIET Phosphatidylserine decarboxylase proenzyme OS=Acidovorax ebreus (strain TPSY) GN=psd PE=3 SV=1 146 254 3.0E-09
sp|Q9KDA3|PSD_BACHD Phosphatidylserine decarboxylase proenzyme OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=psd PE=3 SV=1 146 356 4.0E-09
sp|B4S0J5|PSD_ALTMD Phosphatidylserine decarboxylase proenzyme OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=psd PE=3 SV=1 146 356 4.0E-09
sp|Q1I433|PSD_PSEE4 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas entomophila (strain L48) GN=psd PE=3 SV=1 145 346 5.0E-09
sp|Q5KWX3|PSD_GEOKA Phosphatidylserine decarboxylase proenzyme OS=Geobacillus kaustophilus (strain HTA426) GN=psd PE=3 SV=1 136 347 5.0E-09
sp|C3LR71|PSD_VIBCM Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain M66-2) GN=psd PE=3 SV=1 131 260 5.0E-09
sp|Q9KV19|PSD_VIBCH Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=psd PE=3 SV=1 131 260 5.0E-09
sp|A5F3N7|PSD_VIBC3 Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=psd PE=3 SV=1 131 260 5.0E-09
sp|Q47C25|PSD_DECAR Phosphatidylserine decarboxylase proenzyme OS=Dechloromonas aromatica (strain RCB) GN=psd PE=3 SV=1 146 254 5.0E-09
sp|Q3KJ03|PSD_PSEPF Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf0-1) GN=psd PE=3 SV=1 145 346 9.0E-09
sp|Q2NW88|PSD_SODGM Phosphatidylserine decarboxylase proenzyme OS=Sodalis glossinidius (strain morsitans) GN=psd PE=3 SV=1 146 353 1.0E-08
sp|A1SZV9|PSD_PSYIN Phosphatidylserine decarboxylase proenzyme OS=Psychromonas ingrahamii (strain 37) GN=psd PE=3 SV=1 146 348 1.0E-08
sp|A1U4D6|PSD_MARHV Phosphatidylserine decarboxylase proenzyme OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=psd PE=3 SV=1 92 350 1.0E-08
sp|Q6F6W3|PSD_ACIAD Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 146 347 1.0E-08
sp|B1JAE9|PSD_PSEPW Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain W619) GN=psd PE=3 SV=1 145 346 1.0E-08
sp|Q07XV9|PSD_SHEFN Phosphatidylserine decarboxylase proenzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=psd PE=3 SV=1 146 347 1.0E-08
sp|C0Z4E2|PSD_BREBN Phosphatidylserine decarboxylase proenzyme OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=psd PE=3 SV=1 146 339 2.0E-08
sp|A1KBF9|PSD_AZOSB Phosphatidylserine decarboxylase proenzyme OS=Azoarcus sp. (strain BH72) GN=psd PE=3 SV=1 138 254 2.0E-08
sp|C3KDM6|PSD_PSEFS Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain SBW25) GN=psd PE=3 SV=1 145 346 3.0E-08
sp|B7GKA2|PSD_ANOFW Phosphatidylserine decarboxylase proenzyme OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=psd PE=3 SV=1 142 349 3.0E-08
sp|Q2YB83|PSD_NITMU Phosphatidylserine decarboxylase proenzyme OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=psd PE=3 SV=1 146 348 4.0E-08
sp|Q7MYS6|PSD_PHOLL Phosphatidylserine decarboxylase proenzyme OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=psd PE=3 SV=1 104 351 5.0E-08
sp|Q1GZE8|PSD_METFK Phosphatidylserine decarboxylase proenzyme OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=psd PE=3 SV=1 146 355 6.0E-08
sp|Q8D2C6|PSD_WIGBR Phosphatidylserine decarboxylase proenzyme OS=Wigglesworthia glossinidia brevipalpis GN=psd PE=3 SV=1 145 353 6.0E-08
sp|Q5QVW0|PSD_IDILO Phosphatidylserine decarboxylase proenzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=psd PE=3 SV=1 99 347 7.0E-08
sp|B0KL10|PSD_PSEPG Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain GB-1) GN=psd PE=3 SV=1 145 346 8.0E-08
sp|A5W9U4|PSD_PSEP1 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=psd PE=3 SV=1 145 346 8.0E-08
sp|Q88DB9|PSD_PSEPK Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain KT2440) GN=psd PE=3 SV=1 145 346 9.0E-08
sp|A2SJL1|PSD_METPP Phosphatidylserine decarboxylase proenzyme OS=Methylibium petroleiphilum (strain PM1) GN=psd PE=3 SV=1 146 254 9.0E-08
sp|Q9CJU2|PSD_PASMU Phosphatidylserine decarboxylase proenzyme OS=Pasteurella multocida (strain Pm70) GN=psd PE=3 SV=1 146 254 1.0E-07
sp|Q87DS7|PSD_XYLFT Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=psd PE=3 SV=1 144 264 1.0E-07
sp|B2I9I2|PSD_XYLF2 Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M23) GN=psd PE=3 SV=1 144 264 1.0E-07
sp|Q7P0H6|PSD_CHRVO Phosphatidylserine decarboxylase proenzyme OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=psd PE=3 SV=1 97 254 1.0E-07
sp|B5Y342|PSD_KLEP3 Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae (strain 342) GN=psd PE=3 SV=1 145 353 1.0E-07
sp|C4K3T9|PSD_HAMD5 Phosphatidylserine decarboxylase proenzyme OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=psd PE=3 SV=1 131 351 2.0E-07
sp|A1WIF0|PSD_VEREI Phosphatidylserine decarboxylase proenzyme OS=Verminephrobacter eiseniae (strain EF01-2) GN=psd PE=3 SV=1 145 254 2.0E-07
sp|C1DLP2|PSD_AZOVD Phosphatidylserine decarboxylase proenzyme OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=psd PE=3 SV=1 138 254 4.0E-07
sp|Q9PDL4|PSD_XYLFA Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain 9a5c) GN=psd PE=3 SV=1 144 264 6.0E-07
sp|B0U6J7|PSD_XYLFM Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M12) GN=psd PE=3 SV=1 144 264 6.0E-07
sp|B0UWL4|PSD_HISS2 Phosphatidylserine decarboxylase proenzyme OS=Histophilus somni (strain 2336) GN=psd PE=3 SV=1 146 260 6.0E-07
sp|Q47VZ2|PSD_COLP3 Phosphatidylserine decarboxylase proenzyme OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=psd PE=3 SV=1 142 339 7.0E-07
sp|C5CU16|PSD_VARPS Phosphatidylserine decarboxylase proenzyme OS=Variovorax paradoxus (strain S110) GN=psd PE=3 SV=1 146 254 8.0E-07
sp|A1VUQ1|PSD_POLNA Phosphatidylserine decarboxylase proenzyme OS=Polaromonas naphthalenivorans (strain CJ2) GN=psd PE=3 SV=1 146 254 1.0E-06
sp|B4SQW4|PSD_STRM5 Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain R551-3) GN=psd PE=3 SV=1 137 254 1.0E-06
sp|B2FP04|PSD_STRMK Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain K279a) GN=psd PE=3 SV=1 137 254 1.0E-06
sp|Q221E5|PSD_RHOFT Phosphatidylserine decarboxylase proenzyme OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=psd PE=3 SV=2 146 254 2.0E-06
sp|A1JIQ6|PSD_YERE8 Phosphatidylserine decarboxylase proenzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=psd PE=3 SV=1 146 339 2.0E-06
sp|Q0I4T3|PSD_HAES1 Phosphatidylserine decarboxylase proenzyme OS=Haemophilus somnus (strain 129Pt) GN=psd PE=3 SV=1 146 260 2.0E-06
sp|Q7VNA7|PSD_HAEDU Phosphatidylserine decarboxylase proenzyme OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=psd PE=3 SV=1 146 254 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008654 phospholipid biosynthetic process Yes
GO:0004609 phosphatidylserine decarboxylase activity Yes
GO:0019637 organophosphate metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0016829 lyase activity No
GO:1901576 organic substance biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0016830 carbon-carbon lyase activity No
GO:0044249 cellular biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0016831 carboxy-lyase activity No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup309
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2710
Ophiocordyceps australis map64 (Brazil) OphauB2|5632
Ophiocordyceps australis map64 (Brazil) OphauB2|5656 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00043
Ophiocordyceps camponoti-rufipedis Ophun1|6281
Ophiocordyceps kimflemingae Ophio5|2558
Ophiocordyceps subramaniannii Hirsu2|1125
Ophiocordyceps subramaniannii Hirsu2|3028
Ophiocordyceps subramaniannii Hirsu2|3864
Ophiocordyceps subramaniannii Hirsu2|989

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5656
MFDEVPRKKPYWRDPQGERQIRDYEHMLAALNHVLTRAPEWTDTHEGMGVVGVPLNALFDYAMGTPSGHAAFLDP
EVNKMIKKVLNAWGEYLKTPESAHVLDKHALGWFGEAALRDLVEVGNAPLGTSFTFEELYECDPTAKHYGFNSWD
DFFTRKIRDKARPVASPNNDSVIVNACESKPYNVAHNIKLRDCFYAKGHPYSALDMLGHDERARHFAGGTVYQAF
LCALSYHRWHSPVSGTIVRRFVVEGTYFSKPLSNDAAQQPTWHTDTQCLEHSQGYLSAMATRAVVFIEADNPDIG
LVAFVGIGIVEVSTCHVTVAEGQWVNKGDELGMFHFGGSSYCVVFGKHVKLHDFPPVDRQQNVPVRGKLAVVTH*
Coding >OphauB2|5656
ATGTTTGACGAGGTGCCGCGCAAGAAGCCCTACTGGCGCGATCCCCAGGGCGAGCGTCAGATTAGAGACTATGAG
CACATGCTTGCGGCGCTCAACCACGTCTTGACGCGGGCGCCCGAGTGGACAGACACGCACGAGGGCATGGGAGTG
GTGGGAGTGCCCTTGAATGCCCTTTTCGACTATGCCATGGGCACTCCGAGCGGCCATGCTGCGTTTCTGGACCCA
GAGGTGAATAAAATGATTAAAAAGGTGCTCAATGCGTGGGGAGAGTACCTCAAGACACCCGAATCAGCACATGTG
CTTGACAAGCATGCGCTGGGCTGGTTTGGCGAGGCAGCTCTCCGTGATCTCGTCGAGGTGGGCAACGCACCCCTG
GGCACAAGCTTTACCTTTGAAGAGCTGTACGAATGCGACCCAACAGCCAAGCACTATGGCTTCAACTCGTGGGAC
GACTTCTTTACCCGCAAGATTCGCGACAAGGCGCGTCCAGTAGCATCGCCAAACAACGACTCCGTCATTGTCAAT
GCCTGCGAGTCAAAGCCTTACAATGTCGCGCACAACATCAAGCTCAGAGACTGCTTCTACGCCAAAGGCCATCCC
TACTCTGCGCTCGACATGCTCGGCCACGACGAGCGAGCGCGCCACTTTGCCGGCGGCACCGTCTACCAAGCCTTT
TTATGCGCCCTCTCGTACCATCGCTGGCACTCGCCCGTTTCCGGCACCATTGTGCGCCGCTTCGTCGTCGAGGGC
ACCTACTTCAGCAAGCCGCTCAGCAACGACGCCGCGCAGCAGCCCACTTGGCACACCGACACCCAATGCCTAGAG
CACAGCCAGGGCTATCTCTCCGCCATGGCGACGCGCGCAGTCGTCTTCATCGAGGCGGATAACCCCGACATTGGC
CTCGTCGCCTTTGTGGGCATTGGCATCGTCGAGGTGAGCACGTGCCACGTCACCGTTGCCGAGGGCCAGTGGGTC
AACAAGGGCGACGAGCTGGGCATGTTTCACTTTGGCGGCTCGTCCTACTGCGTCGTCTTTGGCAAGCATGTAAAG
CTGCACGACTTTCCGCCCGTCGACAGGCAGCAAAATGTCCCGGTGCGCGGCAAGCTCGCCGTGGTGACGCATTGA
Transcript >OphauB2|5656
ATGTTTGACGAGGTGCCGCGCAAGAAGCCCTACTGGCGCGATCCCCAGGGCGAGCGTCAGATTAGAGACTATGAG
CACATGCTTGCGGCGCTCAACCACGTCTTGACGCGGGCGCCCGAGTGGACAGACACGCACGAGGGCATGGGAGTG
GTGGGAGTGCCCTTGAATGCCCTTTTCGACTATGCCATGGGCACTCCGAGCGGCCATGCTGCGTTTCTGGACCCA
GAGGTGAATAAAATGATTAAAAAGGTGCTCAATGCGTGGGGAGAGTACCTCAAGACACCCGAATCAGCACATGTG
CTTGACAAGCATGCGCTGGGCTGGTTTGGCGAGGCAGCTCTCCGTGATCTCGTCGAGGTGGGCAACGCACCCCTG
GGCACAAGCTTTACCTTTGAAGAGCTGTACGAATGCGACCCAACAGCCAAGCACTATGGCTTCAACTCGTGGGAC
GACTTCTTTACCCGCAAGATTCGCGACAAGGCGCGTCCAGTAGCATCGCCAAACAACGACTCCGTCATTGTCAAT
GCCTGCGAGTCAAAGCCTTACAATGTCGCGCACAACATCAAGCTCAGAGACTGCTTCTACGCCAAAGGCCATCCC
TACTCTGCGCTCGACATGCTCGGCCACGACGAGCGAGCGCGCCACTTTGCCGGCGGCACCGTCTACCAAGCCTTT
TTATGCGCCCTCTCGTACCATCGCTGGCACTCGCCCGTTTCCGGCACCATTGTGCGCCGCTTCGTCGTCGAGGGC
ACCTACTTCAGCAAGCCGCTCAGCAACGACGCCGCGCAGCAGCCCACTTGGCACACCGACACCCAATGCCTAGAG
CACAGCCAGGGCTATCTCTCCGCCATGGCGACGCGCGCAGTCGTCTTCATCGAGGCGGATAACCCCGACATTGGC
CTCGTCGCCTTTGTGGGCATTGGCATCGTCGAGGTGAGCACGTGCCACGTCACCGTTGCCGAGGGCCAGTGGGTC
AACAAGGGCGACGAGCTGGGCATGTTTCACTTTGGCGGCTCGTCCTACTGCGTCGTCTTTGGCAAGCATGTAAAG
CTGCACGACTTTCCGCCCGTCGACAGGCAGCAAAATGTCCCGGTGCGCGGCAAGCTCGCCGTGGTGACGCATTGA
Gene >OphauB2|5656
ATGTTTGACGAGGTGCCGCGCAAGAAGCCCTACTGGCGCGATCCCCAGGGCGAGCGTCAGATTAGAGACTATGAG
CACATGCTTGCGGCGCTCAACCACGTCTTGACGCGGGCGCCCGAGTGGACAGACACGCACGAGGGCATGGGAGTG
GTGGGAGTGCCCTTGAATGCCCTTTTCGACTATGCCATGGGCACTCCGAGGCAAGAGTCGCCCCATTGTTTGTTT
CTTGGTAATGGCTTTTGCCGACGACTTGAGCTGACTTGATTAGCGGCCATGCTGCGTTTCTGGACCCAGAGGTGA
ATAAAATGATTAAAAAGGTGCTCAATGCGTGGGGAGAGTACCTCAAGGTTGGCGGCATTTGCGTCAAGTAATAGC
AAGCATCTGCCAACCCTCTTGATTTCCCCAGACACCCGAATCAGCACATGTGCTTGACAAGCATGCGCTGGGCTG
GTTTGGCGAGGCAGCTCTCCGTGATCTCGTCGAGGTGGGCAACGCACCCCTGGGCACAAGCTTTACCTTTGAAGA
GCTGTACGAATGCGACCCAACAGCCAAGCACTATGGCTTCAACTCGTGGGACGGTATGCTGCGTCTCTGGCTCCT
GCATGCCAAAAAAAAACAGGCATAAAAAAAAAACCTCATGCTGTGCCAGACTTCTTTACCCGCAAGATTCGCGAC
AAGGCGCGTCCAGTAGCATCGCCAAACAACGACTCCGTCATTGTCAATGCCTGCGAGTCAAAGCCTTACAATGTC
GCGCACAACATCAAGCTCAGAGACTGCTTCTACGCCAAAGGCCATCCCTACTCTGCGCTCGACATGCTCGGCCAC
GACGAGCGAGCGCGCCACTTTGCCGGCGGCACCGTCTACCAAGCCTTTTTATGCGCCCTCTCGTACCATCGCTGG
CACTCGCCCGTTTCCGGCACCATTGTGCGCCGCTTCGTCGTCGAGGGCACCTACTTCAGCAAGCCGCTCAGCAAC
GACGCCGCGCAGCAGCCCACTTGGCACACCGACACCCAATGCCTAGAGCACAGCCAGGGCTATCTCTCCGCCATG
GCGACGCGCGCAGTCGTCTTCATCGAGGCGGATAACCCCGACATTGGCCTCGTCGCCTTTGTGGGCATTGGCATC
GTCGAGGTGAGCACGTGCCACGTCACCGTTGCCGAGGGCCAGTGGGTCAACAAGGGCGACGAGCTGGGCATGTTT
CACTTTGGCGGCTCGTCCTACTGCGTCGTCTTTGGCAAGCATGTAAAGCTGCACGACTTTCCGCCCGTCGACAGG
CAGCAAAATGTCCCGGTGCGCGGCAAGCTCGCCGTGGTGACGCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail