Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5652
Gene name
LocationContig_45:122904..124725
Strand+
Gene length (bp)1821
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14479 HeLo Prion-inhibition and propagation 5.9E-22 12 194

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5652
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1703
Ophiocordyceps australis map64 (Brazil) OphauB2|5652 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4686
Ophiocordyceps kimflemingae Ophio5|4672
Ophiocordyceps subramaniannii Hirsu2|8023

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5652
MDTQAAVVQVAFHGACFALHILRSSLHFSHAAERLILNLEMERFRLLIWGQNSGLAPPPGQPPRLPSRLEAISSV
INSHLDGIARLLQDAQVLRARYGLQETLEQPSSSATVRRLLERMQATLGAMGIPSDATLGSNDGEMKKRLHWWDS
PAKRLRWAVCDLDRFSALVDDLASRISKLNQLLTETQQVSAQQDGERVSILLVGSVADGQALHLLLAAAKQTPIP
SATRARVENLAICANVPLPHLVPASLALSDFVLPPSFASKRRFLAAKTSDSVAGAVHLFERKDFDPNIGPREKRM
LVARIQHLVSLLSKPKTPEFKTPLALGCIHDAARFCWWMVHRLPPFSAWPVSPSCQLGFEPVSLAALLHPRARFR
PPLEQRYALASHICATLSELFSSSWLHKGIRSENIIFCVPAMPEPGLLPAQSSQLLKSVLVCGFDYSRQESEQSS
IDKARLSGNVPTAMFRHPSYQGDAAEGYKMEYDVYSLGLVLVEIALWTPLASFLQPKPASSSVSKSQNDASHLSP
NMTLFHEPHAAALKRRVTHTVDAEFAFRLGSQYHEAIKFCLEFADLDPRPQDDEFPTHPSLEFYNKVVVPLSRLQ
RGFLSE*
Coding >OphauB2|5652
ATGGACACTCAGGCAGCCGTGGTCCAAGTCGCCTTTCACGGCGCCTGCTTTGCCCTCCACATCCTCCGCTCCTCG
CTCCACTTCTCCCACGCCGCCGAGCGCCTCATTCTCAACCTGGAAATGGAGCGTTTCCGCCTCCTCATCTGGGGC
CAAAACAGCGGCCTCGCGCCCCCGCCCGGCCAGCCGCCCCGTCTGCCCAGCCGTCTCGAGGCCATAAGCTCCGTC
ATCAACAGCCATCTCGACGGCATTGCGCGCCTGCTGCAGGACGCGCAGGTGCTGCGTGCGCGCTATGGCTTGCAG
GAGACGCTCGAGCAGCCGAGTTCGTCGGCCACGGTGCGGCGTCTGCTGGAGCGGATGCAGGCCACTCTTGGCGCC
ATGGGGATTCCTAGTGATGCCACCTTGGGAAGTAATGATGGCGAGATGAAGAAACGACTGCACTGGTGGGATTCG
CCGGCCAAGCGGCTTCGTTGGGCAGTCTGCGACTTGGACAGGTTTAGTGCCCTGGTGGACGACTTGGCCAGCCGC
ATCTCCAAACTCAACCAGCTCCTCACCGAGACGCAGCAAGTCTCGGCGCAGCAAGACGGCGAGCGCGTCAGCATC
CTTCTTGTCGGCAGCGTGGCTGATGGGCAAGCGCTGCACCTGCTCCTCGCCGCCGCCAAGCAGACGCCCATCCCG
TCAGCCACCAGGGCCCGCGTAGAAAACCTGGCCATTTGCGCCAATGTCCCGCTGCCGCACCTTGTGCCCGCCAGC
CTCGCGCTCAGCGACTTTGTTCTCCCGCCGTCCTTTGCCAGCAAGAGGCGCTTCTTGGCTGCCAAGACGAGCGAT
TCCGTGGCCGGAGCAGTCCATCTCTTTGAGCGCAAAGACTTTGACCCAAACATTGGCCCGCGCGAAAAGAGGATG
CTTGTTGCGCGCATCCAGCATCTCGTCAGCCTCTTATCCAAGCCCAAGACGCCCGAGTTTAAAACGCCCCTTGCC
CTGGGCTGTATCCACGATGCCGCCCGTTTTTGCTGGTGGATGGTTCATCGTCTCCCCCCCTTTTCCGCATGGCCA
GTCTCGCCGTCTTGCCAGCTTGGCTTTGAGCCCGTCTCCCTTGCTGCGCTTCTACACCCCAGGGCAAGGTTTCGG
CCTCCGCTGGAGCAGCGATATGCGCTTGCTAGCCACATTTGCGCCACGCTGTCGGAGCTCTTTTCAAGTAGTTGG
CTGCACAAGGGCATTCGCAGCGAGAATATAATCTTTTGCGTCCCCGCCATGCCCGAGCCGGGACTCTTGCCCGCG
CAGAGCAGCCAGTTGCTAAAGTCGGTGCTGGTATGCGGCTTTGACTATTCGCGCCAGGAGAGCGAGCAGAGCTCC
ATTGACAAGGCGCGGCTGTCGGGCAACGTGCCAACAGCAATGTTTCGCCATCCCAGCTACCAGGGCGACGCGGCA
GAGGGATACAAGATGGAGTATGATGTATACTCGCTCGGTCTCGTCTTGGTGGAAATCGCCCTCTGGACGCCGCTT
GCCTCCTTTCTTCAGCCAAAGCCCGCCTCGTCCAGTGTCAGCAAGTCGCAAAACGACGCCTCGCACCTCTCGCCA
AACATGACTCTTTTCCACGAGCCGCACGCAGCAGCCCTAAAGAGGCGAGTCACGCACACCGTAGACGCCGAGTTT
GCCTTTCGCCTTGGCTCGCAGTATCACGAGGCCATCAAGTTTTGTCTCGAGTTTGCAGACCTTGACCCAAGGCCC
CAAGACGACGAGTTTCCCACTCACCCTTCCCTAGAGTTTTACAACAAGGTTGTCGTGCCCTTGTCCAGACTGCAA
AGGGGCTTTTTGTCAGAGTGA
Transcript >OphauB2|5652
ATGGACACTCAGGCAGCCGTGGTCCAAGTCGCCTTTCACGGCGCCTGCTTTGCCCTCCACATCCTCCGCTCCTCG
CTCCACTTCTCCCACGCCGCCGAGCGCCTCATTCTCAACCTGGAAATGGAGCGTTTCCGCCTCCTCATCTGGGGC
CAAAACAGCGGCCTCGCGCCCCCGCCCGGCCAGCCGCCCCGTCTGCCCAGCCGTCTCGAGGCCATAAGCTCCGTC
ATCAACAGCCATCTCGACGGCATTGCGCGCCTGCTGCAGGACGCGCAGGTGCTGCGTGCGCGCTATGGCTTGCAG
GAGACGCTCGAGCAGCCGAGTTCGTCGGCCACGGTGCGGCGTCTGCTGGAGCGGATGCAGGCCACTCTTGGCGCC
ATGGGGATTCCTAGTGATGCCACCTTGGGAAGTAATGATGGCGAGATGAAGAAACGACTGCACTGGTGGGATTCG
CCGGCCAAGCGGCTTCGTTGGGCAGTCTGCGACTTGGACAGGTTTAGTGCCCTGGTGGACGACTTGGCCAGCCGC
ATCTCCAAACTCAACCAGCTCCTCACCGAGACGCAGCAAGTCTCGGCGCAGCAAGACGGCGAGCGCGTCAGCATC
CTTCTTGTCGGCAGCGTGGCTGATGGGCAAGCGCTGCACCTGCTCCTCGCCGCCGCCAAGCAGACGCCCATCCCG
TCAGCCACCAGGGCCCGCGTAGAAAACCTGGCCATTTGCGCCAATGTCCCGCTGCCGCACCTTGTGCCCGCCAGC
CTCGCGCTCAGCGACTTTGTTCTCCCGCCGTCCTTTGCCAGCAAGAGGCGCTTCTTGGCTGCCAAGACGAGCGAT
TCCGTGGCCGGAGCAGTCCATCTCTTTGAGCGCAAAGACTTTGACCCAAACATTGGCCCGCGCGAAAAGAGGATG
CTTGTTGCGCGCATCCAGCATCTCGTCAGCCTCTTATCCAAGCCCAAGACGCCCGAGTTTAAAACGCCCCTTGCC
CTGGGCTGTATCCACGATGCCGCCCGTTTTTGCTGGTGGATGGTTCATCGTCTCCCCCCCTTTTCCGCATGGCCA
GTCTCGCCGTCTTGCCAGCTTGGCTTTGAGCCCGTCTCCCTTGCTGCGCTTCTACACCCCAGGGCAAGGTTTCGG
CCTCCGCTGGAGCAGCGATATGCGCTTGCTAGCCACATTTGCGCCACGCTGTCGGAGCTCTTTTCAAGTAGTTGG
CTGCACAAGGGCATTCGCAGCGAGAATATAATCTTTTGCGTCCCCGCCATGCCCGAGCCGGGACTCTTGCCCGCG
CAGAGCAGCCAGTTGCTAAAGTCGGTGCTGGTATGCGGCTTTGACTATTCGCGCCAGGAGAGCGAGCAGAGCTCC
ATTGACAAGGCGCGGCTGTCGGGCAACGTGCCAACAGCAATGTTTCGCCATCCCAGCTACCAGGGCGACGCGGCA
GAGGGATACAAGATGGAGTATGATGTATACTCGCTCGGTCTCGTCTTGGTGGAAATCGCCCTCTGGACGCCGCTT
GCCTCCTTTCTTCAGCCAAAGCCCGCCTCGTCCAGTGTCAGCAAGTCGCAAAACGACGCCTCGCACCTCTCGCCA
AACATGACTCTTTTCCACGAGCCGCACGCAGCAGCCCTAAAGAGGCGAGTCACGCACACCGTAGACGCCGAGTTT
GCCTTTCGCCTTGGCTCGCAGTATCACGAGGCCATCAAGTTTTGTCTCGAGTTTGCAGACCTTGACCCAAGGCCC
CAAGACGACGAGTTTCCCACTCACCCTTCCCTAGAGTTTTACAACAAGGTTGTCGTGCCCTTGTCCAGACTGCAA
AGGGGCTTTTTGTCAGAGTGA
Gene >OphauB2|5652
ATGGACACTCAGGCAGCCGTGGTCCAAGTCGCCTTTCACGGCGCCTGCTTTGCCCTCCACATCCTCCGCTCCTCG
CTCCACTTCTCCCACGCCGCCGAGCGCCTCATTCTCAACCTGGAAATGGAGCGTTTCCGCCTCCTCATCTGGGGC
CAAAACAGCGGCCTCGCGCCCCCGCCCGGCCAGCCGCCCCGTCTGCCCAGCCGTCTCGAGGCCATAAGCTCCGTC
ATCAACAGCCATCTCGACGGCATTGCGCGCCTGCTGCAGGACGCGCAGGTGCTGCGTGCGCGCTATGGCTTGCAG
GAGACGCTCGAGCAGCCGAGTTCGTCGGCCACGGTGCGGCGTCTGCTGGAGCGGATGCAGGCCACTCTTGGCGCC
ATGGGGATTCCTAGTGATGCCACCTTGGGAAGTAATGATGGCGAGATGAAGAAACGACTGCACTGGTGGGATTCG
CCGGCCAAGCGGCTTCGTTGGGCAGTCTGCGACTTGGACAGGTTTAGTGCCCTGGTGGACGACTTGGCCAGCCGC
ATCTCCAAACTCAACCAGCTCCTCACCGAGACGCAGCAAGTCTCGGCGCAGCAAGACGGCGAGCGCGTCAGCATC
CTTCTTGTCGGCAGCGTGGCTGATGGGCAAGCGCTGCACCTGCTCCTCGCCGCCGCCAAGCAGACGCCCATCCCG
TCAGCCACCAGGGCCCGCGTAGAAAACCTGGCCATTTGCGCCAATGTCCCGCTGCCGCACCTTGTGCCCGCCAGC
CTCGCGCTCAGCGACTTTGTTCTCCCGCCGTCCTTTGCCAGCAAGAGGCGCTTCTTGGCTGCCAAGACGAGCGAT
TCCGTGGCCGGAGCAGTCCATCTCTTTGAGCGCAAAGACTTTGACCCAAACATTGGCCCGCGCGAAAAGAGGATG
CTTGTTGCGCGCATCCAGCATCTCGTCAGCCTCTTATCCAAGCCCAAGACGCCCGAGTTTAAAACGCCCCTTGCC
CTGGGCTGTATCCACGATGCCGCCCGTTTTTGCTGGTGGATGGTTCATCGTCTCCCCCCCTTTTCCGCATGGCCA
GTCTCGCCGTCTTGCCAGCTTGGCTTTGAGCCCGTCTCCCTTGCTGCGCTTCTACACCCCAGGGCAAGGTTTCGG
CCTCCGCTGGAGCAGCGATATGCGCTTGCTAGCCACATTTGCGCCACGCTGTCGGAGCTCTTTTCAAGTAGTTGG
CTGCACAAGGGCATTCGCAGCGAGAATATAATCTTTTGCGTCCCCGCCATGCCCGAGCCGGGACTCTTGCCCGCG
CAGAGCAGCCAGTTGCTAAAGTCGGTGCTGGTATGCGGCTTTGACTATTCGCGCCAGGAGAGCGAGCAGAGCTCC
ATTGACAAGGCGCGGCTGTCGGGCAACGTGCCAACAGCAATGTTTCGCCATCCCAGCTACCAGGGCGACGCGGCA
GAGGGATACAAGATGGAGTATGATGTATACTCGCTCGGTCTCGTCTTGGTGGAAATCGCCCTCTGGACGCCGCTT
GCCTCCTTTCTTCAGCCAAAGCCCGCCTCGTCCAGTGTCAGCAAGTCGCAAAACGACGCCTCGCACCTCTCGCCA
AACATGACTCTTTTCCACGAGCCGCACGCAGCAGCCCTAAAGAGGCGAGTCACGCACACCGTAGACGCCGAGTTT
GCCTTTCGCCTTGGCTCGCAGTATCACGAGGCCATCAAGTTTTGTCTCGAGTTTGCAGACCTTGACCCAAGGCCC
CAAGACGACGAGTTTCCCACTCACCCTTCCCTAGAGTTTTACAACAAGGTTGTCGTGCCCTTGTCCAGACTGCAA
AGGGGCTTTTTGTCAGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail