Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5651
Gene name
LocationContig_45:118632..122685
Strand-
Gene length (bp)4053
Transcript length (bp)4053
Coding sequence length (bp)4053
Protein length (aa) 1351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.9E-19 94 286
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.7E-17 70 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 81 286 9.0E-12
sp|Q5XF57|Y5576_ARATH Probable receptor-like serine/threonine-protein kinase At5g57670 OS=Arabidopsis thaliana GN=At5g57670 PE=2 SV=1 85 308 2.0E-10
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 64 283 2.0E-10
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 68 298 3.0E-10
sp|A8R7E6|CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1 71 286 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 81 286 9.0E-12
sp|Q5XF57|Y5576_ARATH Probable receptor-like serine/threonine-protein kinase At5g57670 OS=Arabidopsis thaliana GN=At5g57670 PE=2 SV=1 85 308 2.0E-10
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 64 283 2.0E-10
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 68 298 3.0E-10
sp|A8R7E6|CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1 71 286 4.0E-10
sp|Q60855|RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Ripk1 PE=1 SV=1 67 283 7.0E-10
sp|Q8H1D6|RBK1_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK1 OS=Arabidopsis thaliana GN=RBK1 PE=1 SV=1 85 282 1.0E-09
sp|Q5VJL3|GDT9_DICDI Probable serine/threonine-protein kinase gdt9 OS=Dictyostelium discoideum GN=gdt9 PE=2 SV=2 72 288 1.0E-09
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 133 299 2.0E-09
sp|Q55GE6|ROCO7_DICDI Probable serine/threonine-protein kinase roco7 OS=Dictyostelium discoideum GN=roco7 PE=3 SV=1 133 286 2.0E-09
sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1 88 316 3.0E-09
sp|Q75JK0|ZAK1_DICDI Dual specificity protein kinase zakA OS=Dictyostelium discoideum GN=zakA PE=1 SV=1 133 286 3.0E-09
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 68 286 3.0E-09
sp|P32593|MOS_MSVMT Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus (strain ts110) GN=V-MOS PE=3 SV=1 133 284 9.0E-09
sp|P18160|SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum GN=splA PE=1 SV=3 91 286 9.0E-09
sp|Q54Y90|Y0133_DICDI Probable serine/threonine-protein kinase DDB_G0278665 OS=Dictyostelium discoideum GN=DDB_G0278665 PE=3 SV=1 95 279 1.0E-08
sp|P00538|MOS_MSVMO Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus GN=V-MOS PE=3 SV=1 133 284 1.0E-08
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 64 309 2.0E-08
sp|Q3ECH2|Y1670_ARATH Probable receptor-like protein kinase At1g67000 OS=Arabidopsis thaliana GN=At1g67000 PE=2 SV=2 133 327 2.0E-08
sp|Q55CY9|GDT8_DICDI Probable serine/threonine-protein kinase gdt8 OS=Dictyostelium discoideum GN=gdt8 PE=3 SV=1 95 288 3.0E-08
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 98 286 4.0E-08
sp|Q55GG4|Y9847_DICDI Probable serine/threonine-protein kinase DDB_G0267686 OS=Dictyostelium discoideum GN=DDB_G0267686 PE=3 SV=1 88 286 5.0E-08
sp|Q3EDL4|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2 133 292 6.0E-08
sp|Q54TA1|DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum GN=drkC PE=3 SV=1 95 284 6.0E-08
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 94 284 8.0E-08
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 89 286 8.0E-08
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 95 305 1.0E-07
sp|H2KZU7|SVH2_CAEEL Tyrosine-protein kinase receptor svh-2 OS=Caenorhabditis elegans GN=svh-2 PE=1 SV=1 133 310 1.0E-07
sp|D7SFH9|GPDL2_ARATH Glycerophosphodiester phosphodiesterase protein kinase domain-containing GDPDL2 OS=Arabidopsis thaliana GN=GDPDL2 PE=1 SV=1 133 286 2.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 121 289 2.0E-07
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 133 286 2.0E-07
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 124 324 3.0E-07
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 85 286 3.0E-07
sp|Q15569|TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens GN=TESK1 PE=1 SV=2 50 282 3.0E-07
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 100 282 4.0E-07
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 121 289 4.0E-07
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 94 284 4.0E-07
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 121 289 4.0E-07
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 100 287 6.0E-07
sp|Q55CZ1|GDT2_DICDI Probable serine/threonine-protein kinase gdt2 OS=Dictyostelium discoideum GN=gdt2 PE=2 SV=1 94 286 8.0E-07
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 68 309 1.0E-06
sp|Q1PEM5|PERK3_ARATH Proline-rich receptor-like protein kinase PERK3 OS=Arabidopsis thaliana GN=PERK3 PE=2 SV=2 132 294 1.0E-06
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 157 286 1.0E-06
sp|O65405|CRK28_ARATH Cysteine-rich receptor-like protein kinase 28 OS=Arabidopsis thaliana GN=CRK28 PE=3 SV=2 133 282 1.0E-06
sp|Q9FID6|Y5392_ARATH Probable receptor-like protein kinase At5g39020 OS=Arabidopsis thaliana GN=At5g39020 PE=2 SV=1 133 282 1.0E-06
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 100 287 1.0E-06
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 121 289 1.0E-06
sp|P10741|MOS_CHICK Serine/threonine-protein kinase mos OS=Gallus gallus GN=MOS PE=3 SV=1 133 300 2.0E-06
sp|P00537|MOS_MSVMM Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus (strain m1) GN=V-MOS PE=3 SV=1 133 284 2.0E-06
sp|Q8H1G6|PTI11_ARATH PTI1-like tyrosine-protein kinase 1 OS=Arabidopsis thaliana GN=PTI11 PE=1 SV=1 133 307 2.0E-06
sp|P07331|MOS_MSVMH Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus (strain HT-1) GN=V-MOS PE=2 SV=1 133 284 3.0E-06
sp|P10421|MOS_MSVTS Serine/threonine-protein kinase-transforming protein mos OS=Myeloproliferative sarcoma virus (isolate ts159) GN=V-MOS PE=3 SV=1 133 284 3.0E-06
sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Arabidopsis thaliana GN=APK1B PE=2 SV=2 69 395 3.0E-06
sp|Q00655|KSYK_PIG Tyrosine-protein kinase SYK OS=Sus scrofa GN=SYK PE=1 SV=1 133 296 3.0E-06
sp|P00536|MOS_MOUSE Proto-oncogene serine/threonine-protein kinase mos OS=Mus musculus GN=Mos PE=2 SV=2 133 284 4.0E-06
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 132 261 4.0E-06
sp|Q8MY86|FGFR1_DUGJA Fibroblast growth factor receptor 1 OS=Dugesia japonica GN=FGFR1 PE=2 SV=1 67 296 6.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 655 1040 7.0E-06
sp|O49339|PTI12_ARATH PTI1-like tyrosine-protein kinase 2 OS=Arabidopsis thaliana GN=PTI12 PE=1 SV=1 133 307 8.0E-06
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 133 317 8.0E-06
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 69 281 8.0E-06
sp|Q9ASQ6|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana GN=RFK1 PE=2 SV=3 133 281 8.0E-06
sp|Q90ZY4|SBK1_DANRE Serine/threonine-protein kinase SBK1 OS=Danio rerio GN=sbk1 PE=1 SV=1 157 290 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5651
MTSYVFRSALAASASAASSSGDGSCQTSLSASHGSFAAFVCHAAHLQDKLRSEESVFADPDSLWTASRSSIGQGS
SFMVEKVQVGEREGNKARLWRHKAVVVKTVRQHGLDAPSWRGILLEMRVLLHEPIRYHPNIVRLLDISCDAPSHS
ASPFPALVQEWAEFGTLAALQQGLGDALAFGIKQKLCYDVSRGLSILHACGIVHGDLKHENVLVFVNRYAQPAGQ
PYTAKVADFGGTVLQTTRDTSSAVPMLTFPYEAPEIDERLTGDAAKKTDVFSYGMLVWRCMLDGNDVLAAMGFLL
PHGRPSMQQRRELKRLKQTDGLLEAALCTLARHVSTRSLPQESLGLAMSVLMLTLSGDASKRALDRAQARLRGMS
SRDAHDYVIVKDIANAQLERNRKDATRGIDVDGVGYALGRSAGDDYDAQNNLPGFRPDLPQPDSGGAVFEPAKLR
RLLDWTQQQDMVRGFEAAAKDQVAELPSSSAALFLFESHLTGFGVVQSPSEACRWLRVAAAAKEQRESVECRASA
WVVRIHQALGEPNPQSLAEQVEVLCWAATWGHVRCGDEARRVMAAARLEEREEAWGGMVEEAERKCRALTSGTGM
PIFIARRLTRKWDTQSVAEMDLLVEQELGSAYPSSLRKKGQESLESQESQIHESREGQESQESQTLETGEGQESP
LDGIRVNNKGHGLVHLVASQGNLAMLTHLHRTYTCNINLANQSHADSPLTCACRTGHLACALYLLTHGAHPNGPP
FAQEAPLHCLAAFSPSDLPLAAAALLSAGADIERATNAARKDVRAIWADWEDDASICTTPLGRAVLQQSVAAVRE
LLAWGASPWQERDGEGRAVVQPVVLAAVLTLPHILQLLLDAQPAEETRFDEEDMLRVARGGQATPYDSLSLLSRL
VRCGARYKKDLAQTLAILRTRAASTTASPSHVPGAQLCREIELGNADIVDTLLGLGHAPLGSPRHQPLVAAVAMN
DLPTLRLLLRHGAALSSVEEPLLVVLASRPQSTPPGIALAQFLLDNGVDADAAHANGPSALALAIRNRFFDLADL
LIPRCNPSAINAPCVWPGTRAPDSLLGCLVASHSFSHLQSLEHLAAAHASPSTPLAVLPQTASSSALHRLAQLPA
SAWNSHSQVSDRILHLVLAMFPQPHSLRELHVDDRLGTPLTAAIMAANHHVLTTLLHSPYRADCHTSVRVQYSLF
GAQAAHATTAPALALKLALDALDSASQPASPSPSPLIPELETRVEIATELNPASRELLAARLETCRAAMYPPCLP
HPLSDNMPVDLSIISEEKPTAWRQGDDAMTDQDATRTFLNALRRTEGIGHPVTVAMDQAFNKRPLEQSQQETSCE
*
Coding >OphauB2|5651
ATGACGAGCTACGTCTTTCGGTCCGCCTTGGCAGCCTCGGCCTCGGCCGCGTCGTCGAGCGGTGATGGGTCGTGT
CAGACAAGCTTGAGCGCCAGCCACGGCAGCTTTGCCGCCTTTGTCTGCCACGCAGCGCATCTACAAGACAAGCTC
CGCTCAGAGGAAAGCGTGTTTGCCGACCCCGACAGTCTGTGGACGGCCTCGCGAAGCAGCATTGGCCAAGGCAGC
TCCTTTATGGTGGAAAAGGTGCAAGTGGGCGAGCGGGAGGGCAACAAGGCTCGACTCTGGCGACACAAGGCCGTC
GTGGTGAAGACGGTGCGGCAGCATGGCCTGGACGCTCCTTCATGGCGCGGCATCCTGCTCGAGATGCGCGTGCTG
CTTCACGAGCCGATTCGCTACCACCCAAACATTGTACGGCTGCTCGACATTTCATGCGACGCGCCCAGCCACTCA
GCCTCGCCCTTTCCAGCGCTCGTGCAGGAATGGGCCGAGTTTGGCACGCTGGCAGCGCTGCAGCAGGGCTTGGGC
GACGCGCTGGCCTTTGGCATCAAGCAAAAGCTGTGCTACGACGTCAGCCGCGGTCTCTCCATCCTACACGCCTGC
GGCATCGTGCACGGCGACCTCAAGCATGAAAACGTGCTCGTCTTTGTCAACCGCTACGCCCAGCCGGCCGGGCAG
CCATATACGGCAAAGGTGGCCGACTTTGGCGGCACCGTGTTGCAGACGACGCGAGACACGAGCAGTGCGGTGCCC
ATGCTTACCTTTCCTTACGAGGCGCCCGAGATTGACGAGCGGCTGACGGGCGACGCGGCCAAGAAGACGGACGTC
TTTTCCTACGGCATGCTCGTGTGGCGCTGCATGCTTGATGGCAACGACGTCTTGGCCGCCATGGGCTTTTTGCTT
CCCCACGGCCGCCCAAGCATGCAGCAGAGGAGAGAGCTCAAACGCCTCAAGCAGACTGACGGCTTGCTCGAGGCG
GCGCTATGCACTCTAGCTCGCCATGTGTCGACGCGCAGCCTCCCGCAAGAGAGCCTAGGCCTTGCCATGTCGGTT
CTCATGCTCACGCTCAGCGGCGACGCCAGCAAAAGAGCCCTGGACCGCGCCCAGGCTCGCCTACGCGGCATGAGC
AGCCGCGACGCGCACGACTATGTCATCGTCAAGGACATTGCAAACGCACAGCTCGAGCGAAACCGCAAAGACGCC
ACTCGCGGCATCGACGTGGACGGCGTGGGCTACGCGCTCGGCCGCTCCGCCGGCGACGACTACGACGCGCAAAAC
AACCTGCCTGGCTTCCGGCCCGACCTGCCGCAGCCCGACTCTGGCGGCGCAGTCTTTGAGCCGGCCAAGCTGCGG
CGGCTGCTCGACTGGACGCAGCAACAAGACATGGTGCGCGGCTTCGAGGCAGCCGCCAAAGACCAAGTGGCGGAG
CTGCCGTCCAGCTCGGCAGCCTTGTTTCTCTTTGAGAGCCATCTAACTGGCTTTGGCGTTGTGCAGAGTCCGAGC
GAGGCCTGTCGCTGGCTGCGCGTCGCGGCGGCGGCCAAGGAGCAGCGCGAGAGCGTCGAGTGCAGGGCGTCGGCG
TGGGTGGTGCGCATCCACCAGGCGCTGGGCGAGCCGAATCCGCAATCACTGGCAGAGCAGGTCGAGGTTCTCTGC
TGGGCGGCCACGTGGGGGCATGTGCGCTGCGGAGACGAGGCAAGAAGAGTCATGGCTGCGGCGAGACTGGAGGAG
AGGGAGGAGGCGTGGGGGGGGATGGTGGAGGAGGCGGAGAGAAAGTGTCGCGCGCTGACGAGTGGGACGGGGATG
CCGATTTTTATAGCGCGGCGGCTGACGCGCAAGTGGGATACGCAGAGTGTGGCGGAGATGGATTTGCTTGTCGAG
CAAGAGCTGGGCAGCGCGTATCCCTCGAGCTTGCGAAAAAAGGGGCAAGAGAGTCTTGAGAGCCAAGAGAGCCAG
ATTCATGAGAGTCGGGAGGGCCAAGAGAGCCAAGAGAGCCAGACTCTTGAGACTGGAGAGGGCCAAGAGAGCCCC
CTAGACGGCATTCGCGTCAACAACAAGGGCCACGGCCTCGTCCACCTCGTCGCCTCCCAGGGCAACCTCGCCATG
CTCACCCACCTCCACCGCACTTATACCTGCAACATCAACCTCGCCAACCAGTCCCACGCCGACTCTCCCCTAACC
TGCGCCTGTCGCACCGGCCACCTCGCCTGCGCCCTCTACCTCCTCACCCACGGCGCCCACCCCAACGGCCCCCCT
TTTGCCCAAGAAGCCCCTCTGCACTGCCTCGCCGCCTTTTCCCCCTCTGACCTTCCCCTTGCCGCCGCCGCCCTC
CTCTCTGCCGGCGCCGACATTGAGCGCGCCACCAATGCCGCGCGCAAAGACGTGCGTGCCATTTGGGCAGACTGG
GAAGACGACGCAAGCATCTGCACCACGCCGCTCGGCCGCGCCGTCTTGCAGCAGAGCGTGGCCGCGGTGCGTGAG
CTGCTGGCGTGGGGGGCTAGCCCCTGGCAGGAGAGAGATGGCGAGGGGAGGGCCGTGGTGCAGCCAGTAGTGTTG
GCGGCGGTGCTGACGTTGCCGCATATCCTGCAGCTTCTCCTCGATGCGCAGCCGGCAGAGGAGACGCGCTTCGAT
GAAGAGGACATGCTGCGGGTGGCGAGGGGCGGGCAGGCAACGCCCTATGATTCTCTGTCTCTGCTGAGCAGGCTG
GTTCGCTGCGGCGCGCGGTATAAAAAAGACCTAGCACAGACGCTGGCCATTTTACGCACCAGAGCCGCTTCCACC
ACAGCTTCTCCCTCGCACGTGCCCGGCGCGCAGCTGTGTCGAGAGATTGAGCTGGGAAATGCCGACATTGTCGAC
ACGCTCCTCGGGCTGGGCCACGCGCCCCTCGGCTCTCCCCGCCACCAACCCCTGGTCGCTGCCGTGGCCATGAAT
GACTTGCCCACGCTGCGTCTGCTCCTCCGCCACGGCGCGGCGCTGAGTAGCGTCGAGGAGCCGCTGCTAGTCGTC
TTGGCGTCGCGGCCGCAGTCGACGCCGCCAGGCATTGCCCTGGCCCAGTTTCTCCTCGACAATGGTGTCGATGCC
GACGCAGCGCATGCCAACGGCCCCAGTGCCCTCGCTCTCGCCATTCGGAACCGATTCTTTGACCTGGCAGACCTC
CTCATCCCTCGCTGTAATCCCTCTGCCATTAATGCCCCGTGCGTCTGGCCCGGCACTCGAGCCCCCGACTCGCTG
CTCGGCTGCCTCGTTGCCTCGCACTCCTTTTCCCATCTGCAAAGCCTCGAGCATCTCGCCGCCGCCCACGCCTCG
CCCTCGACTCCTCTAGCCGTGCTCCCGCAAACAGCCTCCTCCTCTGCCCTCCACCGCCTCGCCCAGCTACCCGCC
AGCGCCTGGAACTCGCACTCGCAAGTCTCTGACCGCATCCTCCACCTCGTCCTCGCCATGTTTCCCCAGCCGCAC
AGCCTGCGCGAGCTCCACGTCGACGACCGCCTCGGCACGCCCCTGACGGCTGCCATCATGGCCGCCAACCACCAC
GTGCTGACCACGCTGCTCCACTCTCCCTACCGCGCCGACTGCCACACCTCGGTCCGCGTCCAATACTCCCTCTTT
GGCGCCCAGGCTGCCCATGCTACCACTGCCCCTGCCCTGGCCCTCAAACTCGCCCTCGACGCCCTCGACTCGGCT
TCCCAGCCTGCCTCTCCCTCTCCCTCTCCCCTCATCCCCGAACTCGAGACGCGCGTCGAAATCGCCACGGAGCTG
AATCCAGCCTCGCGGGAGCTTCTCGCCGCCCGGCTGGAAACGTGCCGCGCCGCAATGTATCCGCCCTGCCTGCCA
CACCCCTTGTCAGACAATATGCCCGTCGACTTGTCCATTATAAGCGAGGAGAAGCCCACGGCGTGGCGGCAGGGC
GACGACGCCATGACGGACCAAGACGCCACGCGCACCTTTCTCAACGCCCTTCGCCGAACAGAGGGCATTGGCCAT
CCGGTAACTGTTGCCATGGACCAAGCGTTTAATAAGCGCCCGCTCGAGCAGTCTCAACAAGAAACCTCATGTGAA
TAA
Transcript >OphauB2|5651
ATGACGAGCTACGTCTTTCGGTCCGCCTTGGCAGCCTCGGCCTCGGCCGCGTCGTCGAGCGGTGATGGGTCGTGT
CAGACAAGCTTGAGCGCCAGCCACGGCAGCTTTGCCGCCTTTGTCTGCCACGCAGCGCATCTACAAGACAAGCTC
CGCTCAGAGGAAAGCGTGTTTGCCGACCCCGACAGTCTGTGGACGGCCTCGCGAAGCAGCATTGGCCAAGGCAGC
TCCTTTATGGTGGAAAAGGTGCAAGTGGGCGAGCGGGAGGGCAACAAGGCTCGACTCTGGCGACACAAGGCCGTC
GTGGTGAAGACGGTGCGGCAGCATGGCCTGGACGCTCCTTCATGGCGCGGCATCCTGCTCGAGATGCGCGTGCTG
CTTCACGAGCCGATTCGCTACCACCCAAACATTGTACGGCTGCTCGACATTTCATGCGACGCGCCCAGCCACTCA
GCCTCGCCCTTTCCAGCGCTCGTGCAGGAATGGGCCGAGTTTGGCACGCTGGCAGCGCTGCAGCAGGGCTTGGGC
GACGCGCTGGCCTTTGGCATCAAGCAAAAGCTGTGCTACGACGTCAGCCGCGGTCTCTCCATCCTACACGCCTGC
GGCATCGTGCACGGCGACCTCAAGCATGAAAACGTGCTCGTCTTTGTCAACCGCTACGCCCAGCCGGCCGGGCAG
CCATATACGGCAAAGGTGGCCGACTTTGGCGGCACCGTGTTGCAGACGACGCGAGACACGAGCAGTGCGGTGCCC
ATGCTTACCTTTCCTTACGAGGCGCCCGAGATTGACGAGCGGCTGACGGGCGACGCGGCCAAGAAGACGGACGTC
TTTTCCTACGGCATGCTCGTGTGGCGCTGCATGCTTGATGGCAACGACGTCTTGGCCGCCATGGGCTTTTTGCTT
CCCCACGGCCGCCCAAGCATGCAGCAGAGGAGAGAGCTCAAACGCCTCAAGCAGACTGACGGCTTGCTCGAGGCG
GCGCTATGCACTCTAGCTCGCCATGTGTCGACGCGCAGCCTCCCGCAAGAGAGCCTAGGCCTTGCCATGTCGGTT
CTCATGCTCACGCTCAGCGGCGACGCCAGCAAAAGAGCCCTGGACCGCGCCCAGGCTCGCCTACGCGGCATGAGC
AGCCGCGACGCGCACGACTATGTCATCGTCAAGGACATTGCAAACGCACAGCTCGAGCGAAACCGCAAAGACGCC
ACTCGCGGCATCGACGTGGACGGCGTGGGCTACGCGCTCGGCCGCTCCGCCGGCGACGACTACGACGCGCAAAAC
AACCTGCCTGGCTTCCGGCCCGACCTGCCGCAGCCCGACTCTGGCGGCGCAGTCTTTGAGCCGGCCAAGCTGCGG
CGGCTGCTCGACTGGACGCAGCAACAAGACATGGTGCGCGGCTTCGAGGCAGCCGCCAAAGACCAAGTGGCGGAG
CTGCCGTCCAGCTCGGCAGCCTTGTTTCTCTTTGAGAGCCATCTAACTGGCTTTGGCGTTGTGCAGAGTCCGAGC
GAGGCCTGTCGCTGGCTGCGCGTCGCGGCGGCGGCCAAGGAGCAGCGCGAGAGCGTCGAGTGCAGGGCGTCGGCG
TGGGTGGTGCGCATCCACCAGGCGCTGGGCGAGCCGAATCCGCAATCACTGGCAGAGCAGGTCGAGGTTCTCTGC
TGGGCGGCCACGTGGGGGCATGTGCGCTGCGGAGACGAGGCAAGAAGAGTCATGGCTGCGGCGAGACTGGAGGAG
AGGGAGGAGGCGTGGGGGGGGATGGTGGAGGAGGCGGAGAGAAAGTGTCGCGCGCTGACGAGTGGGACGGGGATG
CCGATTTTTATAGCGCGGCGGCTGACGCGCAAGTGGGATACGCAGAGTGTGGCGGAGATGGATTTGCTTGTCGAG
CAAGAGCTGGGCAGCGCGTATCCCTCGAGCTTGCGAAAAAAGGGGCAAGAGAGTCTTGAGAGCCAAGAGAGCCAG
ATTCATGAGAGTCGGGAGGGCCAAGAGAGCCAAGAGAGCCAGACTCTTGAGACTGGAGAGGGCCAAGAGAGCCCC
CTAGACGGCATTCGCGTCAACAACAAGGGCCACGGCCTCGTCCACCTCGTCGCCTCCCAGGGCAACCTCGCCATG
CTCACCCACCTCCACCGCACTTATACCTGCAACATCAACCTCGCCAACCAGTCCCACGCCGACTCTCCCCTAACC
TGCGCCTGTCGCACCGGCCACCTCGCCTGCGCCCTCTACCTCCTCACCCACGGCGCCCACCCCAACGGCCCCCCT
TTTGCCCAAGAAGCCCCTCTGCACTGCCTCGCCGCCTTTTCCCCCTCTGACCTTCCCCTTGCCGCCGCCGCCCTC
CTCTCTGCCGGCGCCGACATTGAGCGCGCCACCAATGCCGCGCGCAAAGACGTGCGTGCCATTTGGGCAGACTGG
GAAGACGACGCAAGCATCTGCACCACGCCGCTCGGCCGCGCCGTCTTGCAGCAGAGCGTGGCCGCGGTGCGTGAG
CTGCTGGCGTGGGGGGCTAGCCCCTGGCAGGAGAGAGATGGCGAGGGGAGGGCCGTGGTGCAGCCAGTAGTGTTG
GCGGCGGTGCTGACGTTGCCGCATATCCTGCAGCTTCTCCTCGATGCGCAGCCGGCAGAGGAGACGCGCTTCGAT
GAAGAGGACATGCTGCGGGTGGCGAGGGGCGGGCAGGCAACGCCCTATGATTCTCTGTCTCTGCTGAGCAGGCTG
GTTCGCTGCGGCGCGCGGTATAAAAAAGACCTAGCACAGACGCTGGCCATTTTACGCACCAGAGCCGCTTCCACC
ACAGCTTCTCCCTCGCACGTGCCCGGCGCGCAGCTGTGTCGAGAGATTGAGCTGGGAAATGCCGACATTGTCGAC
ACGCTCCTCGGGCTGGGCCACGCGCCCCTCGGCTCTCCCCGCCACCAACCCCTGGTCGCTGCCGTGGCCATGAAT
GACTTGCCCACGCTGCGTCTGCTCCTCCGCCACGGCGCGGCGCTGAGTAGCGTCGAGGAGCCGCTGCTAGTCGTC
TTGGCGTCGCGGCCGCAGTCGACGCCGCCAGGCATTGCCCTGGCCCAGTTTCTCCTCGACAATGGTGTCGATGCC
GACGCAGCGCATGCCAACGGCCCCAGTGCCCTCGCTCTCGCCATTCGGAACCGATTCTTTGACCTGGCAGACCTC
CTCATCCCTCGCTGTAATCCCTCTGCCATTAATGCCCCGTGCGTCTGGCCCGGCACTCGAGCCCCCGACTCGCTG
CTCGGCTGCCTCGTTGCCTCGCACTCCTTTTCCCATCTGCAAAGCCTCGAGCATCTCGCCGCCGCCCACGCCTCG
CCCTCGACTCCTCTAGCCGTGCTCCCGCAAACAGCCTCCTCCTCTGCCCTCCACCGCCTCGCCCAGCTACCCGCC
AGCGCCTGGAACTCGCACTCGCAAGTCTCTGACCGCATCCTCCACCTCGTCCTCGCCATGTTTCCCCAGCCGCAC
AGCCTGCGCGAGCTCCACGTCGACGACCGCCTCGGCACGCCCCTGACGGCTGCCATCATGGCCGCCAACCACCAC
GTGCTGACCACGCTGCTCCACTCTCCCTACCGCGCCGACTGCCACACCTCGGTCCGCGTCCAATACTCCCTCTTT
GGCGCCCAGGCTGCCCATGCTACCACTGCCCCTGCCCTGGCCCTCAAACTCGCCCTCGACGCCCTCGACTCGGCT
TCCCAGCCTGCCTCTCCCTCTCCCTCTCCCCTCATCCCCGAACTCGAGACGCGCGTCGAAATCGCCACGGAGCTG
AATCCAGCCTCGCGGGAGCTTCTCGCCGCCCGGCTGGAAACGTGCCGCGCCGCAATGTATCCGCCCTGCCTGCCA
CACCCCTTGTCAGACAATATGCCCGTCGACTTGTCCATTATAAGCGAGGAGAAGCCCACGGCGTGGCGGCAGGGC
GACGACGCCATGACGGACCAAGACGCCACGCGCACCTTTCTCAACGCCCTTCGCCGAACAGAGGGCATTGGCCAT
CCGGTAACTGTTGCCATGGACCAAGCGTTTAATAAGCGCCCGCTCGAGCAGTCTCAACAAGAAACCTCATGTGAA
TAA
Gene >OphauB2|5651
ATGACGAGCTACGTCTTTCGGTCCGCCTTGGCAGCCTCGGCCTCGGCCGCGTCGTCGAGCGGTGATGGGTCGTGT
CAGACAAGCTTGAGCGCCAGCCACGGCAGCTTTGCCGCCTTTGTCTGCCACGCAGCGCATCTACAAGACAAGCTC
CGCTCAGAGGAAAGCGTGTTTGCCGACCCCGACAGTCTGTGGACGGCCTCGCGAAGCAGCATTGGCCAAGGCAGC
TCCTTTATGGTGGAAAAGGTGCAAGTGGGCGAGCGGGAGGGCAACAAGGCTCGACTCTGGCGACACAAGGCCGTC
GTGGTGAAGACGGTGCGGCAGCATGGCCTGGACGCTCCTTCATGGCGCGGCATCCTGCTCGAGATGCGCGTGCTG
CTTCACGAGCCGATTCGCTACCACCCAAACATTGTACGGCTGCTCGACATTTCATGCGACGCGCCCAGCCACTCA
GCCTCGCCCTTTCCAGCGCTCGTGCAGGAATGGGCCGAGTTTGGCACGCTGGCAGCGCTGCAGCAGGGCTTGGGC
GACGCGCTGGCCTTTGGCATCAAGCAAAAGCTGTGCTACGACGTCAGCCGCGGTCTCTCCATCCTACACGCCTGC
GGCATCGTGCACGGCGACCTCAAGCATGAAAACGTGCTCGTCTTTGTCAACCGCTACGCCCAGCCGGCCGGGCAG
CCATATACGGCAAAGGTGGCCGACTTTGGCGGCACCGTGTTGCAGACGACGCGAGACACGAGCAGTGCGGTGCCC
ATGCTTACCTTTCCTTACGAGGCGCCCGAGATTGACGAGCGGCTGACGGGCGACGCGGCCAAGAAGACGGACGTC
TTTTCCTACGGCATGCTCGTGTGGCGCTGCATGCTTGATGGCAACGACGTCTTGGCCGCCATGGGCTTTTTGCTT
CCCCACGGCCGCCCAAGCATGCAGCAGAGGAGAGAGCTCAAACGCCTCAAGCAGACTGACGGCTTGCTCGAGGCG
GCGCTATGCACTCTAGCTCGCCATGTGTCGACGCGCAGCCTCCCGCAAGAGAGCCTAGGCCTTGCCATGTCGGTT
CTCATGCTCACGCTCAGCGGCGACGCCAGCAAAAGAGCCCTGGACCGCGCCCAGGCTCGCCTACGCGGCATGAGC
AGCCGCGACGCGCACGACTATGTCATCGTCAAGGACATTGCAAACGCACAGCTCGAGCGAAACCGCAAAGACGCC
ACTCGCGGCATCGACGTGGACGGCGTGGGCTACGCGCTCGGCCGCTCCGCCGGCGACGACTACGACGCGCAAAAC
AACCTGCCTGGCTTCCGGCCCGACCTGCCGCAGCCCGACTCTGGCGGCGCAGTCTTTGAGCCGGCCAAGCTGCGG
CGGCTGCTCGACTGGACGCAGCAACAAGACATGGTGCGCGGCTTCGAGGCAGCCGCCAAAGACCAAGTGGCGGAG
CTGCCGTCCAGCTCGGCAGCCTTGTTTCTCTTTGAGAGCCATCTAACTGGCTTTGGCGTTGTGCAGAGTCCGAGC
GAGGCCTGTCGCTGGCTGCGCGTCGCGGCGGCGGCCAAGGAGCAGCGCGAGAGCGTCGAGTGCAGGGCGTCGGCG
TGGGTGGTGCGCATCCACCAGGCGCTGGGCGAGCCGAATCCGCAATCACTGGCAGAGCAGGTCGAGGTTCTCTGC
TGGGCGGCCACGTGGGGGCATGTGCGCTGCGGAGACGAGGCAAGAAGAGTCATGGCTGCGGCGAGACTGGAGGAG
AGGGAGGAGGCGTGGGGGGGGATGGTGGAGGAGGCGGAGAGAAAGTGTCGCGCGCTGACGAGTGGGACGGGGATG
CCGATTTTTATAGCGCGGCGGCTGACGCGCAAGTGGGATACGCAGAGTGTGGCGGAGATGGATTTGCTTGTCGAG
CAAGAGCTGGGCAGCGCGTATCCCTCGAGCTTGCGAAAAAAGGGGCAAGAGAGTCTTGAGAGCCAAGAGAGCCAG
ATTCATGAGAGTCGGGAGGGCCAAGAGAGCCAAGAGAGCCAGACTCTTGAGACTGGAGAGGGCCAAGAGAGCCCC
CTAGACGGCATTCGCGTCAACAACAAGGGCCACGGCCTCGTCCACCTCGTCGCCTCCCAGGGCAACCTCGCCATG
CTCACCCACCTCCACCGCACTTATACCTGCAACATCAACCTCGCCAACCAGTCCCACGCCGACTCTCCCCTAACC
TGCGCCTGTCGCACCGGCCACCTCGCCTGCGCCCTCTACCTCCTCACCCACGGCGCCCACCCCAACGGCCCCCCT
TTTGCCCAAGAAGCCCCTCTGCACTGCCTCGCCGCCTTTTCCCCCTCTGACCTTCCCCTTGCCGCCGCCGCCCTC
CTCTCTGCCGGCGCCGACATTGAGCGCGCCACCAATGCCGCGCGCAAAGACGTGCGTGCCATTTGGGCAGACTGG
GAAGACGACGCAAGCATCTGCACCACGCCGCTCGGCCGCGCCGTCTTGCAGCAGAGCGTGGCCGCGGTGCGTGAG
CTGCTGGCGTGGGGGGCTAGCCCCTGGCAGGAGAGAGATGGCGAGGGGAGGGCCGTGGTGCAGCCAGTAGTGTTG
GCGGCGGTGCTGACGTTGCCGCATATCCTGCAGCTTCTCCTCGATGCGCAGCCGGCAGAGGAGACGCGCTTCGAT
GAAGAGGACATGCTGCGGGTGGCGAGGGGCGGGCAGGCAACGCCCTATGATTCTCTGTCTCTGCTGAGCAGGCTG
GTTCGCTGCGGCGCGCGGTATAAAAAAGACCTAGCACAGACGCTGGCCATTTTACGCACCAGAGCCGCTTCCACC
ACAGCTTCTCCCTCGCACGTGCCCGGCGCGCAGCTGTGTCGAGAGATTGAGCTGGGAAATGCCGACATTGTCGAC
ACGCTCCTCGGGCTGGGCCACGCGCCCCTCGGCTCTCCCCGCCACCAACCCCTGGTCGCTGCCGTGGCCATGAAT
GACTTGCCCACGCTGCGTCTGCTCCTCCGCCACGGCGCGGCGCTGAGTAGCGTCGAGGAGCCGCTGCTAGTCGTC
TTGGCGTCGCGGCCGCAGTCGACGCCGCCAGGCATTGCCCTGGCCCAGTTTCTCCTCGACAATGGTGTCGATGCC
GACGCAGCGCATGCCAACGGCCCCAGTGCCCTCGCTCTCGCCATTCGGAACCGATTCTTTGACCTGGCAGACCTC
CTCATCCCTCGCTGTAATCCCTCTGCCATTAATGCCCCGTGCGTCTGGCCCGGCACTCGAGCCCCCGACTCGCTG
CTCGGCTGCCTCGTTGCCTCGCACTCCTTTTCCCATCTGCAAAGCCTCGAGCATCTCGCCGCCGCCCACGCCTCG
CCCTCGACTCCTCTAGCCGTGCTCCCGCAAACAGCCTCCTCCTCTGCCCTCCACCGCCTCGCCCAGCTACCCGCC
AGCGCCTGGAACTCGCACTCGCAAGTCTCTGACCGCATCCTCCACCTCGTCCTCGCCATGTTTCCCCAGCCGCAC
AGCCTGCGCGAGCTCCACGTCGACGACCGCCTCGGCACGCCCCTGACGGCTGCCATCATGGCCGCCAACCACCAC
GTGCTGACCACGCTGCTCCACTCTCCCTACCGCGCCGACTGCCACACCTCGGTCCGCGTCCAATACTCCCTCTTT
GGCGCCCAGGCTGCCCATGCTACCACTGCCCCTGCCCTGGCCCTCAAACTCGCCCTCGACGCCCTCGACTCGGCT
TCCCAGCCTGCCTCTCCCTCTCCCTCTCCCCTCATCCCCGAACTCGAGACGCGCGTCGAAATCGCCACGGAGCTG
AATCCAGCCTCGCGGGAGCTTCTCGCCGCCCGGCTGGAAACGTGCCGCGCCGCAATGTATCCGCCCTGCCTGCCA
CACCCCTTGTCAGACAATATGCCCGTCGACTTGTCCATTATAAGCGAGGAGAAGCCCACGGCGTGGCGGCAGGGC
GACGACGCCATGACGGACCAAGACGCCACGCGCACCTTTCTCAACGCCCTTCGCCGAACAGAGGGCATTGGCCAT
CCGGTAACTGTTGCCATGGACCAAGCGTTTAATAAGCGCCCGCTCGAGCAGTCTCAACAAGAAACCTCATGTGAA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail