Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5648
Gene name
LocationContig_45:109359..113683
Strand+
Gene length (bp)4324
Transcript length (bp)4200
Coding sequence length (bp)4200
Protein length (aa) 1400

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08801 Nucleoporin_N Nup133 N terminal like 4.4E-92 135 579
PF03177 Nucleoporin_C Non-repetitive/WGA-negative nucleoporin C-terminal 2.7E-47 811 1255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S7B6|NU170_CHATD Nucleoporin NUP170 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP170 PE=1 SV=1 5 1389 0.0E+00
sp|Q9URX8|NG06_SCHPO Probable nucleoporin C890.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC890.06 PE=3 SV=3 93 1379 0.0E+00
sp|P38181|NU170_YEAST Nucleoporin NUP170 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP170 PE=1 SV=1 40 1332 5.0E-140
sp|P40064|NU157_YEAST Nucleoporin NUP157 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP157 PE=1 SV=1 106 1326 1.0E-112
sp|Q99P88|NU155_MOUSE Nuclear pore complex protein Nup155 OS=Mus musculus GN=Nup155 PE=1 SV=1 68 660 6.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S7B6|NU170_CHATD Nucleoporin NUP170 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP170 PE=1 SV=1 5 1389 0.0E+00
sp|Q9URX8|NG06_SCHPO Probable nucleoporin C890.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC890.06 PE=3 SV=3 93 1379 0.0E+00
sp|P38181|NU170_YEAST Nucleoporin NUP170 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP170 PE=1 SV=1 40 1332 5.0E-140
sp|P40064|NU157_YEAST Nucleoporin NUP157 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP157 PE=1 SV=1 106 1326 1.0E-112
sp|Q99P88|NU155_MOUSE Nuclear pore complex protein Nup155 OS=Mus musculus GN=Nup155 PE=1 SV=1 68 660 6.0E-42
sp|O75694|NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 661 1312 3.0E-41
sp|O75694|NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 95 660 1.0E-40
sp|Q99P88|NU155_MOUSE Nuclear pore complex protein Nup155 OS=Mus musculus GN=Nup155 PE=1 SV=1 671 1304 6.0E-40
sp|P37199|NU155_RAT Nuclear pore complex protein Nup155 OS=Rattus norvegicus GN=Nup155 PE=1 SV=1 671 1304 2.0E-39
sp|P37199|NU155_RAT Nuclear pore complex protein Nup155 OS=Rattus norvegicus GN=Nup155 PE=1 SV=1 75 660 3.0E-39
sp|F4HXV6|NU155_ARATH Nuclear pore complex protein NUP155 OS=Arabidopsis thaliana GN=NUP155 PE=1 SV=1 107 419 2.0E-27
sp|F4HXV6|NU155_ARATH Nuclear pore complex protein NUP155 OS=Arabidopsis thaliana GN=NUP155 PE=1 SV=1 768 1205 1.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5648
MAFPPTTPQRPVPGAFLNTPAVVSRYQGGPDAVRRSLFPVPEAGNAATADQSSKPKPPPSSSENAIPPAVASKTA
SATTPSAVPRPENLSPATKAAKAIDSFLKLDASFPDLDTYCKQGASSDYDLSTPESCWAPFQKTHMYPIPNQIFN
QYDSSQLQTIMGLFAEINHAWVVIDNCLFLWDYTRHDPELIGFEEQPQTIHSVALVPPKPGIFVNTITHILVVAT
SSEMILLGVSTADTPAGTKSVSLYQTKMSLAIRGNDVRIITGTDDGRIFFGGCADTDVSELFYQSEERWFSNRCG
RINHSNPGWSSVVTLQAVLWRTETPEHLIDIVVDSSRRLLYTLSSKSTIRTYHMDAPNRLVKIITKEKVDCLRDI
THMITSSVLLTDASKIVSLSSISKLEASKLHLMALTDTGCRLFFSATSASSYLYGSSDSMVPQSMQVQYIKFPPS
QAPRSSTAAPNAEPVVDMTSKALVGSRQGLRFPPGYFLDLMHSENNANTDLLFVSGPDTGRIKRSSPTQPVRYYE
QGSWLDIGSRAEAIGLVTKPFAATSQPAGFGNELAVQFDEPSSEFAVLTNTGIHVIRRRRLVDTFAAAIRDSPGD
EAIETVTRRLIQLYGRVEVVSTALAVACGNGGDVRSNVARAKDQMIEVRAKSLFIDFGSQPSVSENDGMTLTVDS
VKLSARHDALALYISRLVRKLWNTLVVKSSIPPGGGITVDSVVPLANLVNTQENIEHLRNFLESNRGLIQGMSGP
PDAQAVASQQEEVALQAEHQALHALQKLLESISEGISFVLMLFDERVSEIFTRLDETTRGEVTSLTYEKLFSQTE
GKELAKVLVKAIVNRNIESGSNVETVADALRRRCGSFCSAEDVVVFKAQEQLKLASEKPTTVSRSLLHESLKLFE
KVAGSLSPSNLQSTVQQYVALKYYAGAIQLCLVVARERDRGNSALMWVSDGKPDNDPRVEAFNKRKRCYDMIYEV
LQQLDVVSSQEPEIVDGKPSLMVTKKIEAYDVVNNSDDELFHYDLYRWYLEHGWIDRILATDSPHVIKFLQDLAG
MSVEHANLLCRFYTSRNRFFDAAQVQADLAYSNFALGIKERIKLLSLAKANASVATIGVSRQEQQYLTHQVGETL
DIGNVQDDLLGRLLADERLDAGRKEEVTQVLDGRILSLSDLFNNYADQANYYDLCLLMYHLANYRNPSTILTTWT
SLIEQIHDEVMSRRARVEEGAPPPPLPYEAVSGKIQNIAHRTSLDSFVFPIENLVPELCRYALVNQQDGTIGADP
SWPIQLFLVLGVSHDMLLRVLEGVFETQDYGFSGMARNRIIEMIVYLVNDWVAEMRRRGGNGKGVSVGPWVGDLL
TRCEQALPPPGQGSNPGGADLADVRRVLRTLRREVSGLIERVPTGSLRF*
Coding >OphauB2|5648
ATGGCGTTTCCGCCCACGACGCCCCAGCGGCCTGTTCCAGGAGCCTTTCTCAACACCCCAGCAGTCGTATCGAGA
TACCAGGGCGGCCCAGATGCAGTGCGGCGATCCTTGTTCCCCGTTCCCGAGGCTGGCAACGCCGCGACGGCAGAT
CAGAGCTCCAAGCCGAAGCCGCCGCCGTCGAGCAGCGAAAACGCCATTCCGCCTGCTGTGGCATCCAAGACGGCG
TCCGCTACAACTCCTTCAGCTGTCCCTCGCCCTGAGAACCTTTCTCCAGCGACCAAGGCTGCCAAGGCCATAGAT
TCCTTCCTCAAGCTCGACGCCAGCTTCCCTGACCTCGACACTTATTGCAAGCAAGGTGCTTCCTCCGACTATGAC
CTTTCGACGCCCGAATCCTGCTGGGCGCCCTTCCAAAAGACGCACATGTATCCAATCCCCAACCAAATTTTCAAC
CAGTACGACTCGAGTCAGCTGCAAACAATCATGGGGCTCTTTGCCGAGATCAACCACGCATGGGTTGTCATTGAC
AATTGTCTGTTTCTTTGGGACTATACGCGTCACGACCCCGAGCTCATAGGCTTTGAGGAGCAGCCGCAAACAATC
CATTCTGTGGCGCTGGTGCCGCCGAAGCCTGGCATCTTTGTAAATACAATTACTCACATTCTCGTTGTCGCCACT
TCGTCTGAAATGATACTCCTCGGCGTGTCCACTGCCGACACTCCAGCAGGCACCAAATCTGTTAGCCTATACCAA
ACCAAGATGTCGCTGGCAATTCGGGGCAACGATGTCCGCATAATAACGGGCACCGACGACGGCCGCATCTTCTTT
GGAGGCTGTGCCGACACCGACGTCAGCGAACTCTTTTACCAGTCTGAAGAACGGTGGTTTTCCAATCGGTGTGGC
AGAATTAACCATTCAAACCCAGGCTGGTCTTCAGTCGTTACTTTACAGGCAGTGCTTTGGCGAACCGAAACCCCG
GAGCACCTGATTGATATTGTTGTTGACAGCTCAAGGAGGCTCCTCTATACCCTTTCCAGCAAATCAACCATTCGC
ACTTATCACATGGATGCGCCCAACCGTCTTGTCAAAATCATCACCAAGGAAAAGGTGGATTGTCTACGAGACATT
ACCCACATGATCACATCATCAGTGCTGCTCACTGATGCCTCGAAAATCGTATCCCTTAGCTCCATATCCAAATTG
GAAGCATCAAAGCTACACCTCATGGCGCTGACTGACACTGGCTGTCGGTTGTTCTTCAGTGCCACCAGTGCATCA
TCCTACCTTTACGGCTCGTCAGATAGCATGGTTCCCCAGAGCATGCAGGTGCAGTACATCAAGTTTCCTCCCAGC
CAGGCTCCCCGTTCGAGCACGGCAGCACCAAATGCCGAGCCAGTCGTCGACATGACTTCAAAAGCTCTTGTTGGA
AGCAGACAAGGCCTTCGGTTTCCTCCTGGTTATTTTTTGGATCTTATGCACAGCGAGAATAATGCCAATACCGAT
TTACTCTTTGTCTCTGGACCCGATACCGGACGTATAAAACGAAGCTCTCCGACACAGCCTGTCCGATATTACGAA
CAAGGCAGTTGGCTCGATATTGGTAGTCGAGCCGAGGCAATCGGCCTCGTTACGAAACCATTTGCCGCCACGTCG
CAGCCGGCTGGATTTGGAAATGAATTGGCTGTACAGTTTGATGAGCCATCGAGTGAATTTGCCGTCTTAACCAAT
ACCGGGATCCACGTTATCCGCCGGCGCCGTCTGGTTGACACCTTTGCTGCTGCCATACGGGACTCACCTGGTGAT
GAAGCCATTGAGACGGTAACGCGTCGTCTGATTCAACTCTATGGTCGCGTCGAAGTAGTTTCCACGGCACTGGCT
GTCGCCTGTGGCAACGGAGGAGACGTCCGGTCGAATGTGGCGCGAGCAAAAGATCAGATGATTGAGGTCCGAGCA
AAGAGCCTGTTTATTGACTTTGGCTCACAGCCTAGCGTTTCTGAAAACGACGGCATGACACTGACTGTTGACTCG
GTTAAACTGTCGGCGCGCCATGATGCTTTGGCCCTATACATTTCACGCCTGGTTCGCAAGCTTTGGAATACTCTT
GTTGTTAAATCGAGCATCCCGCCAGGGGGAGGAATTACCGTTGACTCGGTTGTCCCGCTTGCGAATCTTGTCAAT
ACCCAGGAAAACATTGAACACCTGAGAAATTTTCTCGAGTCAAATCGTGGCTTGATACAAGGCATGTCTGGTCCT
CCTGATGCGCAAGCCGTTGCTAGTCAACAGGAAGAAGTTGCCTTGCAAGCCGAACATCAGGCTCTTCACGCTCTA
CAGAAACTCTTGGAGAGCATCTCTGAAGGCATTTCGTTTGTTCTCATGCTTTTTGACGAGCGTGTGTCCGAGATT
TTCACCAGGCTGGATGAGACGACGCGTGGGGAGGTGACTAGCCTCACGTACGAAAAGCTCTTTTCACAAACAGAG
GGCAAAGAGCTTGCCAAGGTGCTTGTCAAGGCTATTGTCAACCGCAACATTGAAAGTGGCTCCAACGTGGAAACT
GTGGCAGACGCTCTGAGGAGAAGATGCGGCAGCTTTTGCAGCGCCGAAGACGTGGTTGTTTTTAAGGCACAAGAA
CAGCTCAAATTGGCTTCCGAGAAGCCTACAACGGTGTCGAGATCTCTATTGCACGAGAGTCTCAAGCTTTTTGAA
AAGGTGGCGGGCAGTCTTTCGCCATCCAACCTACAAAGCACCGTCCAGCAATATGTGGCTCTCAAGTACTACGCC
GGGGCGATTCAACTATGCCTTGTTGTAGCTCGAGAAAGGGATCGAGGCAACTCGGCGCTGATGTGGGTGTCTGAC
GGGAAGCCGGACAATGACCCTCGTGTGGAAGCCTTTAACAAACGCAAGCGTTGCTATGATATGATTTATGAGGTC
TTGCAGCAACTTGACGTGGTGTCGAGTCAGGAGCCTGAAATTGTTGATGGTAAGCCATCGTTGATGGTGACCAAG
AAGATTGAGGCATATGATGTTGTTAATAACTCGGATGACGAGTTGTTTCACTATGACTTGTACAGGTGGTATCTA
GAGCATGGTTGGATAGACCGCATTCTGGCTACCGACTCGCCGCACGTCATCAAGTTCCTTCAGGACTTGGCGGGC
ATGAGTGTTGAGCATGCCAACTTGCTGTGCCGCTTCTATACCAGCCGGAACCGTTTCTTCGACGCCGCTCAGGTA
CAGGCTGACCTTGCCTACTCCAACTTTGCTCTGGGCATCAAGGAGCGGATTAAGCTGCTTAGTTTGGCCAAGGCC
AATGCCAGTGTGGCAACTATTGGCGTGAGTCGACAGGAGCAACAGTACCTGACGCATCAAGTGGGCGAGACGCTC
GACATTGGCAATGTCCAGGACGACTTACTGGGACGCCTCTTGGCAGACGAGCGCCTTGATGCTGGCAGAAAGGAA
GAGGTGACGCAAGTACTTGATGGCCGAATTCTAAGCCTTTCAGACCTTTTCAACAACTACGCAGATCAAGCCAAC
TACTACGACTTGTGCTTGCTCATGTATCACTTGGCAAACTACCGCAATCCAAGCACAATCTTGACCACTTGGACC
AGCTTGATTGAGCAGATTCATGATGAGGTCATGTCAAGACGAGCCAGAGTGGAGGAGGGTGCGCCGCCACCACCG
TTGCCGTACGAGGCTGTGTCGGGCAAGATACAAAATATTGCACATCGCACGTCCCTCGACAGCTTTGTTTTCCCG
ATTGAGAACCTGGTGCCCGAACTTTGCCGCTATGCCCTTGTGAACCAACAAGACGGCACGATTGGTGCGGACCCG
AGTTGGCCGATACAACTGTTCCTAGTGCTAGGCGTGTCACACGACATGCTTTTGCGGGTACTCGAGGGAGTGTTT
GAGACTCAAGACTATGGCTTCTCGGGCATGGCACGCAACCGCATTATTGAGATGATAGTTTACCTTGTCAATGAT
TGGGTGGCCGAAATGCGGCGGCGAGGAGGCAATGGAAAGGGAGTCAGCGTGGGCCCGTGGGTTGGCGACTTGCTG
ACGAGATGTGAGCAGGCGCTGCCACCGCCTGGACAAGGCAGCAATCCTGGTGGTGCGGATCTAGCAGATGTGCGG
CGAGTGCTGAGGACGCTGCGGCGAGAAGTGTCGGGGCTGATTGAAAGAGTGCCGACTGGAAGCTTGAGGTTTTGA
Transcript >OphauB2|5648
ATGGCGTTTCCGCCCACGACGCCCCAGCGGCCTGTTCCAGGAGCCTTTCTCAACACCCCAGCAGTCGTATCGAGA
TACCAGGGCGGCCCAGATGCAGTGCGGCGATCCTTGTTCCCCGTTCCCGAGGCTGGCAACGCCGCGACGGCAGAT
CAGAGCTCCAAGCCGAAGCCGCCGCCGTCGAGCAGCGAAAACGCCATTCCGCCTGCTGTGGCATCCAAGACGGCG
TCCGCTACAACTCCTTCAGCTGTCCCTCGCCCTGAGAACCTTTCTCCAGCGACCAAGGCTGCCAAGGCCATAGAT
TCCTTCCTCAAGCTCGACGCCAGCTTCCCTGACCTCGACACTTATTGCAAGCAAGGTGCTTCCTCCGACTATGAC
CTTTCGACGCCCGAATCCTGCTGGGCGCCCTTCCAAAAGACGCACATGTATCCAATCCCCAACCAAATTTTCAAC
CAGTACGACTCGAGTCAGCTGCAAACAATCATGGGGCTCTTTGCCGAGATCAACCACGCATGGGTTGTCATTGAC
AATTGTCTGTTTCTTTGGGACTATACGCGTCACGACCCCGAGCTCATAGGCTTTGAGGAGCAGCCGCAAACAATC
CATTCTGTGGCGCTGGTGCCGCCGAAGCCTGGCATCTTTGTAAATACAATTACTCACATTCTCGTTGTCGCCACT
TCGTCTGAAATGATACTCCTCGGCGTGTCCACTGCCGACACTCCAGCAGGCACCAAATCTGTTAGCCTATACCAA
ACCAAGATGTCGCTGGCAATTCGGGGCAACGATGTCCGCATAATAACGGGCACCGACGACGGCCGCATCTTCTTT
GGAGGCTGTGCCGACACCGACGTCAGCGAACTCTTTTACCAGTCTGAAGAACGGTGGTTTTCCAATCGGTGTGGC
AGAATTAACCATTCAAACCCAGGCTGGTCTTCAGTCGTTACTTTACAGGCAGTGCTTTGGCGAACCGAAACCCCG
GAGCACCTGATTGATATTGTTGTTGACAGCTCAAGGAGGCTCCTCTATACCCTTTCCAGCAAATCAACCATTCGC
ACTTATCACATGGATGCGCCCAACCGTCTTGTCAAAATCATCACCAAGGAAAAGGTGGATTGTCTACGAGACATT
ACCCACATGATCACATCATCAGTGCTGCTCACTGATGCCTCGAAAATCGTATCCCTTAGCTCCATATCCAAATTG
GAAGCATCAAAGCTACACCTCATGGCGCTGACTGACACTGGCTGTCGGTTGTTCTTCAGTGCCACCAGTGCATCA
TCCTACCTTTACGGCTCGTCAGATAGCATGGTTCCCCAGAGCATGCAGGTGCAGTACATCAAGTTTCCTCCCAGC
CAGGCTCCCCGTTCGAGCACGGCAGCACCAAATGCCGAGCCAGTCGTCGACATGACTTCAAAAGCTCTTGTTGGA
AGCAGACAAGGCCTTCGGTTTCCTCCTGGTTATTTTTTGGATCTTATGCACAGCGAGAATAATGCCAATACCGAT
TTACTCTTTGTCTCTGGACCCGATACCGGACGTATAAAACGAAGCTCTCCGACACAGCCTGTCCGATATTACGAA
CAAGGCAGTTGGCTCGATATTGGTAGTCGAGCCGAGGCAATCGGCCTCGTTACGAAACCATTTGCCGCCACGTCG
CAGCCGGCTGGATTTGGAAATGAATTGGCTGTACAGTTTGATGAGCCATCGAGTGAATTTGCCGTCTTAACCAAT
ACCGGGATCCACGTTATCCGCCGGCGCCGTCTGGTTGACACCTTTGCTGCTGCCATACGGGACTCACCTGGTGAT
GAAGCCATTGAGACGGTAACGCGTCGTCTGATTCAACTCTATGGTCGCGTCGAAGTAGTTTCCACGGCACTGGCT
GTCGCCTGTGGCAACGGAGGAGACGTCCGGTCGAATGTGGCGCGAGCAAAAGATCAGATGATTGAGGTCCGAGCA
AAGAGCCTGTTTATTGACTTTGGCTCACAGCCTAGCGTTTCTGAAAACGACGGCATGACACTGACTGTTGACTCG
GTTAAACTGTCGGCGCGCCATGATGCTTTGGCCCTATACATTTCACGCCTGGTTCGCAAGCTTTGGAATACTCTT
GTTGTTAAATCGAGCATCCCGCCAGGGGGAGGAATTACCGTTGACTCGGTTGTCCCGCTTGCGAATCTTGTCAAT
ACCCAGGAAAACATTGAACACCTGAGAAATTTTCTCGAGTCAAATCGTGGCTTGATACAAGGCATGTCTGGTCCT
CCTGATGCGCAAGCCGTTGCTAGTCAACAGGAAGAAGTTGCCTTGCAAGCCGAACATCAGGCTCTTCACGCTCTA
CAGAAACTCTTGGAGAGCATCTCTGAAGGCATTTCGTTTGTTCTCATGCTTTTTGACGAGCGTGTGTCCGAGATT
TTCACCAGGCTGGATGAGACGACGCGTGGGGAGGTGACTAGCCTCACGTACGAAAAGCTCTTTTCACAAACAGAG
GGCAAAGAGCTTGCCAAGGTGCTTGTCAAGGCTATTGTCAACCGCAACATTGAAAGTGGCTCCAACGTGGAAACT
GTGGCAGACGCTCTGAGGAGAAGATGCGGCAGCTTTTGCAGCGCCGAAGACGTGGTTGTTTTTAAGGCACAAGAA
CAGCTCAAATTGGCTTCCGAGAAGCCTACAACGGTGTCGAGATCTCTATTGCACGAGAGTCTCAAGCTTTTTGAA
AAGGTGGCGGGCAGTCTTTCGCCATCCAACCTACAAAGCACCGTCCAGCAATATGTGGCTCTCAAGTACTACGCC
GGGGCGATTCAACTATGCCTTGTTGTAGCTCGAGAAAGGGATCGAGGCAACTCGGCGCTGATGTGGGTGTCTGAC
GGGAAGCCGGACAATGACCCTCGTGTGGAAGCCTTTAACAAACGCAAGCGTTGCTATGATATGATTTATGAGGTC
TTGCAGCAACTTGACGTGGTGTCGAGTCAGGAGCCTGAAATTGTTGATGGTAAGCCATCGTTGATGGTGACCAAG
AAGATTGAGGCATATGATGTTGTTAATAACTCGGATGACGAGTTGTTTCACTATGACTTGTACAGGTGGTATCTA
GAGCATGGTTGGATAGACCGCATTCTGGCTACCGACTCGCCGCACGTCATCAAGTTCCTTCAGGACTTGGCGGGC
ATGAGTGTTGAGCATGCCAACTTGCTGTGCCGCTTCTATACCAGCCGGAACCGTTTCTTCGACGCCGCTCAGGTA
CAGGCTGACCTTGCCTACTCCAACTTTGCTCTGGGCATCAAGGAGCGGATTAAGCTGCTTAGTTTGGCCAAGGCC
AATGCCAGTGTGGCAACTATTGGCGTGAGTCGACAGGAGCAACAGTACCTGACGCATCAAGTGGGCGAGACGCTC
GACATTGGCAATGTCCAGGACGACTTACTGGGACGCCTCTTGGCAGACGAGCGCCTTGATGCTGGCAGAAAGGAA
GAGGTGACGCAAGTACTTGATGGCCGAATTCTAAGCCTTTCAGACCTTTTCAACAACTACGCAGATCAAGCCAAC
TACTACGACTTGTGCTTGCTCATGTATCACTTGGCAAACTACCGCAATCCAAGCACAATCTTGACCACTTGGACC
AGCTTGATTGAGCAGATTCATGATGAGGTCATGTCAAGACGAGCCAGAGTGGAGGAGGGTGCGCCGCCACCACCG
TTGCCGTACGAGGCTGTGTCGGGCAAGATACAAAATATTGCACATCGCACGTCCCTCGACAGCTTTGTTTTCCCG
ATTGAGAACCTGGTGCCCGAACTTTGCCGCTATGCCCTTGTGAACCAACAAGACGGCACGATTGGTGCGGACCCG
AGTTGGCCGATACAACTGTTCCTAGTGCTAGGCGTGTCACACGACATGCTTTTGCGGGTACTCGAGGGAGTGTTT
GAGACTCAAGACTATGGCTTCTCGGGCATGGCACGCAACCGCATTATTGAGATGATAGTTTACCTTGTCAATGAT
TGGGTGGCCGAAATGCGGCGGCGAGGAGGCAATGGAAAGGGAGTCAGCGTGGGCCCGTGGGTTGGCGACTTGCTG
ACGAGATGTGAGCAGGCGCTGCCACCGCCTGGACAAGGCAGCAATCCTGGTGGTGCGGATCTAGCAGATGTGCGG
CGAGTGCTGAGGACGCTGCGGCGAGAAGTGTCGGGGCTGATTGAAAGAGTGCCGACTGGAAGCTTGAGGTTTTGA
Gene >OphauB2|5648
ATGGCGTTTCCGCCCACGACGCCCCAGCGGCCTGTTCCAGGAGCCTTTCTCAACACCCCAGCAGTCGTATCGAGA
TACCAGGGCGGCCCAGATGCAGTGCGGCGATCCTTGTTCCCCGTTCCCGAGGCTGGCAACGCCGCGACGGCAGAT
CAGAGCTCCAAGCCGAAGCCGCCGCCGTCGAGCAGCGAAAACGCCATTCCGCCTGCTGTGGCATCCAAGACGGCG
TCCGCTACAACTCCTTCAGCTGTCCCTCGCCCTGAGAACCTTTCTCCAGCGACCAAGGCTGCCAAGGCCATAGAT
TCCTTCCTCAAGCTCGACGCCAGCTTCCCTGACCTCGACACTTATTGCAAGCGTCAGTATAATGCATCTCGCCAC
TCGTCTGACACGCCATCTTGTTGCTGACAATGAGACAGAAGGTGCTTCCTCCGACTATGACCTTTCGACGCCCGA
ATCCTGCTGGGCGCCCTTCCAAAAGACGCACATGTATCCAATCCCCAACCAAATTTTCAACCAGTACGACTCGAG
TCAGCTGCAAACAATCATGGGGCTCTTTGCCGAGATCAACCACGCATGGGTTGTCATTGACAATTGTCTGTTTCT
TTGGGACTATACGCGTCACGACCCCGAGCTCATAGGCTTTGAGGAGCAGCCGCAAACAATCCATTCTGTGGCGCT
GGTGCCGCCGAAGCCTGGCATCTTTGTAAATACAATTACTCACATTCTCGTTGTCGCCACTTCGTCTGAAATGAT
ACTCCTCGGCGTGTCCACTGCCGACACTCCAGCAGGCACCAAATCTGTTAGCCTATACCAAACCAAGATGTCGCT
GGCAATTCGGGGCAACGATGTCCGCATAATAACGGGCACCGACGACGGCCGCATCTTCTTTGGAGGCTGTGCCGA
CACCGACGTCAGCGAACTCTTTTACCAGTCTGAAGAACGGTGGTTTTCCAATCGGTGTGGCAGAATTAACCATTC
AAACCCAGGCTGGTCTTCAGTCGTTACTTTACAGGCAGTGCTTTGGCGAACCGAAACCCCGGAGCACCTGATTGA
TATTGTTGTTGACAGCTCAAGGAGGCTCCTCTATACCCTTTCCAGCAAATCAACCATTCGCACTTATCACATGGA
TGCGCCCAACCGTCTTGTCAAAATCATCACCAAGGAAAAGGTGGATTGTCTACGAGACATTACCCACATGATCAC
ATCATCAGTGCTGCTCACTGATGCCTCGAAAATCGTATCCCTTAGCTCCATATCCAAATTGGAAGCATCAAAGCT
ACACCTCATGGCGCTGACTGACACTGGCTGTCGGTTGTTCTTCAGTGCCACCAGTGCATCATCCTACCTTTACGG
CTCGTCAGATAGCATGGTTCCCCAGAGCATGCAGGTGCAGTACATCAAGTTTCCTCCCAGCCAGGCTCCCCGTTC
GAGCACGGCAGCACCAAATGCCGAGCCAGTCGTCGACATGACTTCAAAAGCTCTTGTTGGAAGCAGACAAGGCCT
TCGGTTTCCTCCTGGTTATTTTTTGGATCTTATGCACAGCGAGAATAATGCCAATACCGATTTACTCTTTGTCTC
TGGACCCGATACCGGACGTATAAAACGAAGCTCTCCGACACAGCCTGTCCGATATTACGAACAAGGCAGTTGGCT
CGATATTGGTAGTCGAGCCGAGGCAATCGGCCTCGTTACGAAACCATTTGCCGCCACGTCGCAGCCGGCTGGATT
TGGAAATGAATTGGCTGTACAGTTTGATGAGCCATCGAGTGAATTTGCCGTCTTAACCAATACCGGGATCCACGT
TATCCGCCGGCGCCGTCTGGTTGACACCTTTGCTGCTGCCATACGGGACTCACCTGGTGATGAAGCCATTGAGAC
GGTAACGCGTCGTCTGATTCAACTCTATGGTCGCGTCGAAGTAGTTTCCACGGCACTGGCTGTCGCCTGTGGCAA
CGGAGGAGACGTCCGGTCGAATGTGGCGCGAGCAAAAGATCAGATGATTGAGGTCCGAGCAAAGAGCCTGTTTAT
TGACTTTGGCTCACAGCCTAGCGTTTCTGAAAACGACGGCATGACACTGACTGTTGACTCGGTTAAACTGTCGGC
GCGCCATGATGCTTTGGCCCTATACATTTCACGCCTGGTTCGCAAGCTTTGGAATACTCTTGTTGTTAAATCGAG
CATCCCGCCAGGGGGAGGAATTACCGTTGACTCGGTTGTCCCGCTTGCGAATCTTGTCAATACCCAGGAAAACAT
TGAACACCTGAGAAATTTTCTCGAGTCAAATCGTGGCTTGATACAAGGCATGTCTGGTCCTCCTGATGCGCAAGC
CGTTGCTAGTCAACAGGAAGAAGTTGCCTTGCAAGCCGAACATCAGGCTCTTCACGCTCTACAGAAACTCTTGGA
GAGCATCTCTGAAGGCATTTCGTTTGTTCTCATGCTTTTTGACGAGCGTGTGTCCGAGATTTTCACCAGGCTGGA
TGAGACGACGCGTGGGGAGGTGACTAGCCTCACGTACGAAAAGCTCTTTTCACAAACAGAGGGCAAAGAGCTTGC
CAAGGTGCTTGTCAAGGCTATTGTCAACCGCAACATTGAAAGTGGCTCCAACGTGGAAACTGTGGCAGACGCTCT
GAGGAGAAGATGCGGCAGCTTTTGCAGCGCCGAAGACGTGGTTGTTTTTAAGGCACAAGAACAGCTCAAATTGGC
TTCCGAGAAGCCTACAACGGTGTCGAGATCTCTATTGCACGAGAGTCTCAAGCTTTTTGAAAAGGTGGCGGGCAG
TCTTTCGCCATCCAACCTACAAAGCACCGTCCAGCAATATGTGGCTCTCAAGTACTACGCCGGGGCGATTCAACT
ATGCCTTGTTGTAGCTCGAGAAAGGGATCGAGGCAACTCGGCGCTGATGTGGGTGTCTGACGGGAAGCCGGACAA
TGACCCTCGTGTGGAAGCCTTTAACAAACGCAAGCGTTGCTATGATATGATTTATGAGGTCTTGCAGCAACTTGA
CGTGGTGTCGAGTCAGGAGCCTGAAATTGTTGATGGTAAGCCATCGTTGATGGTGACCAAGAAGATTGAGGCATA
TGATGTTGTTAATAACTCGGATGACGAGTTGTTTCACTATGACTTGTACAGGTGGTATCTAGAGCATGGTTGGAT
AGACCGCATTCTGGCTACCGACTCGCCGCACGTCATCAAGTTCCTTCAGGACTTGGCGGGCATGAGTGTTGAGCA
TGCCAACTTGCTGTGCCGCTTCTATACCAGCCGGAACCGTTTCTTCGACGCCGCTCAGGTACAGGCTGACCTTGC
CTACTCCAACTTTGCTCTGGGCATCAAGGAGCGGATTAAGCTGCTTAGTTTGGCCAAGGCCAATGCCAGTGTGGC
AACTATTGGCGTGAGTCGACAGGAGCAACAGTACCTGACGCATCAAGTGGGCGAGACGCTCGACATTGGCAATGT
CCAGGACGACTTACTGGGACGCCTCTTGGCAGACGAGCGCCTTGATGCTGGCAGAAAGGAAGAGGTGACGCAAGT
ACTTGATGGCCGAATTCTAAGCCTTTCAGACGTGAGAGCTCGCTCTATCTCATATAACGTTTGTGCACGGACGAT
TTTGCTGACAAGGTTATAGCTTTTCAACAACTACGCAGATCAAGCCAACTACTACGACTTGTGCTTGCTCATGTA
TCACTTGGCAAACTACCGCAATCCAAGCACAATCTTGACCACTTGGACCAGCTTGATTGAGCAGATTCATGATGA
GGTCATGTCAAGACGAGCCAGAGTGGAGGAGGGTGCGCCGCCACCACCGTTGCCGTACGAGGCTGTGTCGGGCAA
GATACAAAATATTGCACATCGCACGTCCCTCGACAGCTTTGTTTTCCCGATTGAGAACCTGGTGCCCGAACTTTG
CCGCTATGCCCTTGTGAACCAACAAGACGGCACGATTGGTGCGGACCCGAGTTGGCCGATACAACTGTTCCTAGT
GCTAGGCGTGTCACACGACATGCTTTTGCGGGTACTCGAGGGAGTGTTTGAGACTCAAGACTATGGCTTCTCGGG
CATGGCACGCAACCGCATTATTGAGATGATAGTTTACCTTGTCAATGATTGGGTGGCCGAAATGCGGCGGCGAGG
AGGCAATGGAAAGGGAGTCAGCGTGGGCCCGTGGGTTGGCGACTTGCTGACGAGATGTGAGCAGGCGCTGCCACC
GCCTGGACAAGGCAGCAATCCTGGTGGTGCGGATCTAGCAGATGTGCGGCGAGTGCTGAGGACGCTGCGGCGAGA
AGTGTCGGGGCTGATTGAAAGAGTGCCGACTGGAAGCTTGAGGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail