Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5644
Gene name
LocationContig_45:102913..103490
Strand-
Gene length (bp)577
Transcript length (bp)522
Coding sequence length (bp)522
Protein length (aa) 174

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03694 Erg28 Erg28 like protein 7.7E-45 15 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40030|ERG28_YEAST Ergosterol biosynthetic protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG28 PE=1 SV=1 3 172 1.0E-17
sp|Q5R589|ERG28_PONAB Probable ergosterol biosynthetic protein 28 OS=Pongo abelii PE=2 SV=1 14 173 2.0E-15
sp|Q9UKR5|ERG28_HUMAN Probable ergosterol biosynthetic protein 28 OS=Homo sapiens GN=C14orf1 PE=1 SV=1 14 173 2.0E-15
sp|Q9ERY9|ERG28_MOUSE Probable ergosterol biosynthetic protein 28 OS=Mus musculus GN=ORF11 PE=2 SV=1 14 167 1.0E-14
sp|O74820|ERG28_SCHPO Ergosterol biosynthetic protein 28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg28 PE=3 SV=1 11 143 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40030|ERG28_YEAST Ergosterol biosynthetic protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG28 PE=1 SV=1 3 172 1.0E-17
sp|Q5R589|ERG28_PONAB Probable ergosterol biosynthetic protein 28 OS=Pongo abelii PE=2 SV=1 14 173 2.0E-15
sp|Q9UKR5|ERG28_HUMAN Probable ergosterol biosynthetic protein 28 OS=Homo sapiens GN=C14orf1 PE=1 SV=1 14 173 2.0E-15
sp|Q9ERY9|ERG28_MOUSE Probable ergosterol biosynthetic protein 28 OS=Mus musculus GN=ORF11 PE=2 SV=1 14 167 1.0E-14
sp|O74820|ERG28_SCHPO Ergosterol biosynthetic protein 28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg28 PE=3 SV=1 11 143 4.0E-09
sp|O80594|ERG28_ARATH Ergosterol biosynthetic protein 28 OS=Arabidopsis thaliana GN=At1g10030 PE=2 SV=2 73 141 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 105 127 22
3 142 164 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5644
MDTLKSLLPPPKGILPYYMLILSVISIGNSIQAYATLRFSRRVYNGRFIRNTRLNPETDNFDPEDMVNKLVPAPV
SNTSASDQVTPLASRLFGTWTLITCIVRCYAAYNLHIGPVYNIAIWTYVVALGHFASELFIYKTMTFGLPQFFPF
FLASGALVSMCSPLTRQHYVEIN*
Coding >OphauB2|5644
ATGGACACACTAAAATCCTTGCTCCCGCCACCCAAGGGCATCTTGCCCTACTACATGCTCATACTGTCCGTCATC
TCGATTGGCAACTCGATTCAGGCTTACGCAACGCTGCGTTTTTCTCGCCGCGTCTACAATGGCCGTTTTATTAGA
AATACACGACTGAATCCAGAGACTGATAATTTCGACCCCGAGGACATGGTAAACAAGCTGGTTCCCGCCCCAGTC
TCCAACACGTCAGCTTCTGATCAGGTTACGCCTCTCGCGAGCCGCCTTTTTGGCACCTGGACGCTCATCACTTGC
ATTGTGCGCTGCTACGCCGCTTATAATCTGCATATTGGGCCCGTGTACAACATTGCCATATGGACCTACGTTGTT
GCGCTGGGCCACTTTGCTAGCGAGCTATTCATCTATAAGACTATGACTTTCGGCTTGCCGCAATTTTTTCCCTTT
TTCCTGGCGAGCGGAGCCTTGGTGTCCATGTGTTCGCCGCTGACGCGCCAACACTACGTTGAGATCAACTAA
Transcript >OphauB2|5644
ATGGACACACTAAAATCCTTGCTCCCGCCACCCAAGGGCATCTTGCCCTACTACATGCTCATACTGTCCGTCATC
TCGATTGGCAACTCGATTCAGGCTTACGCAACGCTGCGTTTTTCTCGCCGCGTCTACAATGGCCGTTTTATTAGA
AATACACGACTGAATCCAGAGACTGATAATTTCGACCCCGAGGACATGGTAAACAAGCTGGTTCCCGCCCCAGTC
TCCAACACGTCAGCTTCTGATCAGGTTACGCCTCTCGCGAGCCGCCTTTTTGGCACCTGGACGCTCATCACTTGC
ATTGTGCGCTGCTACGCCGCTTATAATCTGCATATTGGGCCCGTGTACAACATTGCCATATGGACCTACGTTGTT
GCGCTGGGCCACTTTGCTAGCGAGCTATTCATCTATAAGACTATGACTTTCGGCTTGCCGCAATTTTTTCCCTTT
TTCCTGGCGAGCGGAGCCTTGGTGTCCATGTGTTCGCCGCTGACGCGCCAACACTACGTTGAGATCAACTAA
Gene >OphauB2|5644
ATGGACACACTAAAATCCTTGCTCCCGCCACCCAAGGGCATCTTGCCCTACTACATGCTCATAGTACGAGACGCG
CTTTGCACCATTTTCAACGATACGCATTGACCGATATCTTTAGCTGTCCGTCATCTCGATTGGCAACTCGATTCA
GGCTTACGCAACGCTGCGTTTTTCTCGCCGCGTCTACAATGGCCGTTTTATTAGAAATACACGACTGAATCCAGA
GACTGATAATTTCGACCCCGAGGACATGGTAAACAAGCTGGTTCCCGCCCCAGTCTCCAACACGTCAGCTTCTGA
TCAGGTTACGCCTCTCGCGAGCCGCCTTTTTGGCACCTGGACGCTCATCACTTGCATTGTGCGCTGCTACGCCGC
TTATAATCTGCATATTGGGCCCGTGTACAACATTGCCATATGGACCTACGTTGTTGCGCTGGGCCACTTTGCTAG
CGAGCTATTCATCTATAAGACTATGACTTTCGGCTTGCCGCAATTTTTTCCCTTTTTCCTGGCGAGCGGAGCCTT
GGTGTCCATGTGTTCGCCGCTGACGCGCCAACACTACGTTGAGATCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail