Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5643
Gene name
LocationContig_45:101502..102840
Strand+
Gene length (bp)1338
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01087 GalP_UDP_transf Galactose-1-phosphate uridyl transferase, N-terminal domain 2.5E-67 7 210
PF02744 GalP_UDP_tr_C Galactose-1-phosphate uridyl transferase, C-terminal domain 9.8E-58 218 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYE7|GAL7_NEUCR Galactose-1-phosphate uridylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gal-7 PE=3 SV=1 1 384 0.0E+00
sp|Q96UI1|GAL7_HYPJE Galactose-1-phosphate uridylyltransferase OS=Hypocrea jecorina GN=gal7 PE=3 SV=1 1 383 0.0E+00
sp|P09580|GAL7_KLULA Galactose-1-phosphate uridylyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL7 PE=3 SV=2 6 379 6.0E-138
sp|Q9HDU5|GAL7_SCHPO Galactose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal7 PE=3 SV=1 1 383 4.0E-136
sp|P08431|GAL7_YEAST Galactose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL7 PE=1 SV=4 10 379 7.0E-128
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYE7|GAL7_NEUCR Galactose-1-phosphate uridylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gal-7 PE=3 SV=1 1 384 0.0E+00
sp|Q96UI1|GAL7_HYPJE Galactose-1-phosphate uridylyltransferase OS=Hypocrea jecorina GN=gal7 PE=3 SV=1 1 383 0.0E+00
sp|P09580|GAL7_KLULA Galactose-1-phosphate uridylyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL7 PE=3 SV=2 6 379 6.0E-138
sp|Q9HDU5|GAL7_SCHPO Galactose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal7 PE=3 SV=1 1 383 4.0E-136
sp|P08431|GAL7_YEAST Galactose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL7 PE=1 SV=4 10 379 7.0E-128
sp|P22714|GAL7_SALTY Galactose-1-phosphate uridylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galT PE=3 SV=2 8 382 1.0E-112
sp|P09148|GAL7_ECOLI Galactose-1-phosphate uridylyltransferase OS=Escherichia coli (strain K12) GN=galT PE=1 SV=2 8 382 5.0E-112
sp|P31764|GAL7_HAEIN Galactose-1-phosphate uridylyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galT PE=3 SV=2 11 384 1.0E-107
sp|Q9VMA2|GALT_DROME Probable galactose-1-phosphate uridylyltransferase OS=Drosophila melanogaster GN=Galt PE=2 SV=2 5 379 1.0E-103
sp|P0CN76|GAL7_CRYNJ Galactose-1-phosphate uridylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GAL7 PE=3 SV=1 6 373 2.0E-102
sp|P0CN77|GAL7_CRYNB Galactose-1-phosphate uridylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GAL7 PE=3 SV=1 6 373 2.0E-102
sp|Q03249|GALT_MOUSE Galactose-1-phosphate uridylyltransferase OS=Mus musculus GN=Galt PE=1 SV=3 11 372 1.0E-101
sp|P43424|GALT_RAT Galactose-1-phosphate uridylyltransferase OS=Rattus norvegicus GN=Galt PE=2 SV=1 11 372 3.0E-100
sp|P07902|GALT_HUMAN Galactose-1-phosphate uridylyltransferase OS=Homo sapiens GN=GALT PE=1 SV=3 7 384 2.0E-98
sp|Q27536|GALT_CAEEL Probable galactose-1-phosphate uridylyltransferase OS=Caenorhabditis elegans GN=ZK1058.3 PE=3 SV=1 12 384 3.0E-80
sp|O33836|GAL7_THEMA Galactose-1-phosphate uridylyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=galT PE=3 SV=1 13 378 3.0E-37
sp|P13212|GAL7_STRLI Galactose-1-phosphate uridylyltransferase OS=Streptomyces lividans GN=galT PE=3 SV=2 81 375 2.0E-23
sp|Q9FK51|AGLUP_ARATH ADP-glucose phosphorylase OS=Arabidopsis thaliana GN=At5g18200 PE=1 SV=1 3 373 1.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0006012 galactose metabolic process Yes
GO:0008108 UDP-glucose:hexose-1-phosphate uridylyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0003674 molecular_function No
GO:0070569 uridylyltransferase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0044281 small molecule metabolic process No
GO:0019318 hexose metabolic process No
GO:0016779 nucleotidyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5643
MPDKVLDDISHRRYNPLTNSWLLVSPHRTKRPWQGAQEDAVPNSLPEYDAKCYLCPGNSRASGDKNPCYEKTFAF
VNDYSAVKEQQPDYRVKTSENDVESLLLRAEGVKGVCYVITFSPKHHLTLADMSAAEILPTVEHWTRIYANHLLA
SNPLSRLAQTQLGDLSLSKDAAPVPRDDYRYLQIFENKGAAMGCSNPHPHCQVWTTSSMPEELGKEFTQKAKYHA
EHGRHMLADYVELELSKGERVLWQNDAFVVVCPWWAIWPFEVLLLPKRHIRSLVDFRPEERLQFAEAIQEITRRY
DNLFECSFPYSSGIHQAPLKGSEEEMECAYFHMHFYPPLLRSATVRKFLVGYELMAEPQRDITPEQATARLRDCG
GELYRKGLKQ*
Coding >OphauB2|5643
ATGCCGGACAAGGTGCTCGACGACATTTCACATCGCCGGTACAACCCGCTCACCAATAGCTGGCTGCTCGTCTCC
CCGCATCGAACCAAGCGCCCGTGGCAGGGCGCACAAGAAGATGCTGTGCCAAACTCGCTGCCGGAATATGATGCC
AAGTGCTACCTGTGCCCGGGAAATTCGCGTGCATCCGGCGATAAGAACCCTTGCTATGAAAAGACGTTTGCCTTT
GTCAACGACTATAGCGCCGTCAAGGAGCAGCAACCAGATTATCGAGTAAAAACATCTGAGAATGACGTCGAATCG
CTCCTCCTCCGCGCCGAGGGCGTCAAGGGCGTTTGCTACGTCATCACCTTTTCGCCCAAGCATCACTTGACTCTA
GCAGACATGTCCGCTGCCGAAATCCTGCCCACAGTAGAACACTGGACGCGCATATACGCCAACCATCTATTGGCT
TCGAACCCGCTGTCACGTCTAGCGCAGACCCAGCTTGGAGACTTGTCTCTTTCCAAGGACGCCGCGCCGGTGCCA
CGCGACGATTATCGCTATTTGCAAATCTTTGAAAACAAGGGAGCTGCCATGGGCTGCTCCAATCCGCATCCACAT
TGCCAAGTCTGGACTACGTCTTCGATGCCCGAGGAATTGGGCAAAGAGTTTACACAAAAGGCAAAGTACCACGCC
GAACATGGGCGCCACATGCTCGCTGACTACGTTGAGCTCGAGCTGTCCAAAGGCGAACGCGTGCTCTGGCAGAAT
GACGCCTTTGTGGTTGTCTGTCCCTGGTGGGCCATCTGGCCGTTTGAGGTGCTTCTACTACCTAAGCGGCACATT
CGCTCCCTGGTTGACTTCCGACCGGAAGAGAGACTTCAGTTCGCCGAGGCCATTCAAGAGATTACGCGACGCTAT
GACAATCTGTTTGAATGTAGCTTCCCATACAGCTCAGGCATTCATCAGGCGCCACTCAAGGGCTCTGAGGAGGAA
ATGGAGTGCGCCTATTTTCACATGCACTTTTATCCACCGCTGCTGCGGTCTGCCACTGTCAGGAAATTCCTTGTT
GGCTATGAACTCATGGCTGAACCACAGCGTGACATTACCCCAGAGCAGGCTACGGCGCGCCTGCGCGACTGTGGA
GGAGAGTTGTATAGAAAAGGGCTCAAGCAGTAG
Transcript >OphauB2|5643
ATGCCGGACAAGGTGCTCGACGACATTTCACATCGCCGGTACAACCCGCTCACCAATAGCTGGCTGCTCGTCTCC
CCGCATCGAACCAAGCGCCCGTGGCAGGGCGCACAAGAAGATGCTGTGCCAAACTCGCTGCCGGAATATGATGCC
AAGTGCTACCTGTGCCCGGGAAATTCGCGTGCATCCGGCGATAAGAACCCTTGCTATGAAAAGACGTTTGCCTTT
GTCAACGACTATAGCGCCGTCAAGGAGCAGCAACCAGATTATCGAGTAAAAACATCTGAGAATGACGTCGAATCG
CTCCTCCTCCGCGCCGAGGGCGTCAAGGGCGTTTGCTACGTCATCACCTTTTCGCCCAAGCATCACTTGACTCTA
GCAGACATGTCCGCTGCCGAAATCCTGCCCACAGTAGAACACTGGACGCGCATATACGCCAACCATCTATTGGCT
TCGAACCCGCTGTCACGTCTAGCGCAGACCCAGCTTGGAGACTTGTCTCTTTCCAAGGACGCCGCGCCGGTGCCA
CGCGACGATTATCGCTATTTGCAAATCTTTGAAAACAAGGGAGCTGCCATGGGCTGCTCCAATCCGCATCCACAT
TGCCAAGTCTGGACTACGTCTTCGATGCCCGAGGAATTGGGCAAAGAGTTTACACAAAAGGCAAAGTACCACGCC
GAACATGGGCGCCACATGCTCGCTGACTACGTTGAGCTCGAGCTGTCCAAAGGCGAACGCGTGCTCTGGCAGAAT
GACGCCTTTGTGGTTGTCTGTCCCTGGTGGGCCATCTGGCCGTTTGAGGTGCTTCTACTACCTAAGCGGCACATT
CGCTCCCTGGTTGACTTCCGACCGGAAGAGAGACTTCAGTTCGCCGAGGCCATTCAAGAGATTACGCGACGCTAT
GACAATCTGTTTGAATGTAGCTTCCCATACAGCTCAGGCATTCATCAGGCGCCACTCAAGGGCTCTGAGGAGGAA
ATGGAGTGCGCCTATTTTCACATGCACTTTTATCCACCGCTGCTGCGGTCTGCCACTGTCAGGAAATTCCTTGTT
GGCTATGAACTCATGGCTGAACCACAGCGTGACATTACCCCAGAGCAGGCTACGGCGCGCCTGCGCGACTGTGGA
GGAGAGTTGTATAGAAAAGGGCTCAAGCAGTAG
Gene >OphauB2|5643
ATGCCGGACAAGGTGCTCGACGACATTTCACATCGCCGGTACAACCCGCTCACCAATAGCTGGCTGCTCGTCTCC
CCGCATCGAACCAAGCGCCCGTGGCAGTGAGTTGCGACTACCGCTAGATTAACGTATATCTGTAAACATTTACTG
ACATGTCCGTTGAGGGGCGCACAAGAAGATGCTGTGCCAAACTCGCTGCCGGAATATGATGCCAAGGCAACAAAC
ACCCAACCTTTGAGATGCTCGACTCAGCCACTGACGCCAGAAAACAGTGCTACCTGTGCCCGGGAAATTCGCGTG
CATCCGGCGATAAGAACCCTTGCTATGAAAAGACGTTTGCCTTTGTCAACGACTATAGCGCCGTCAAGGAGCAGC
AACCAGATTATCGAGTAAAAACATCTGAGAATGGTACTTTTGCCTCGGCTCGTGAAGCTTTTTTTCCCAGACCAA
ATGCGACTAACGTGGCTAGACGTCGAATCGCTCCTCCTCCGCGCCGAGGGCGTCAAGGGCGTTTGCTACGTCATC
ACCTTTTCGCCCAAGCATCACTTGACTCTAGCAGACATGTCCGCTGCCGAAATCCTGCCCACAGTAGAACACTGG
ACGCGCATATACGCCAACCATCTATTGGCTTCGAACCCGCTGTCACGTCTAGCGCAGACCCAGCTTGGAGACTTG
TCTCTTTCCAAGGACGCCGCGCCGGTGCCACGCGACGATTATCGCTATTTGCAAATCTTTGAAAACAAGGGAGCT
GCCATGGGCTGCTCCAATCCGCATCCACATTGCCAAGTCTGGACTACGTCTTCGATGCCCGAGGAATTGGGCAAA
GAGTTTACACAAAAGGCAAAGTACCACGCCGAACATGGGCGCCACATGCTCGCTGACTACGTTGAGCTCGAGCTG
TCCAAAGGCGAACGCGTGCTCTGGCAGAATGACGCCTTTGTGGTTGTCTGTCCCTGGTGGGCCATCTGGCCGTTT
GAGGTGCTTCTACTACCTAAGCGGCACATTCGCTCCCTGGTTGACTTCCGACCGGAAGAGAGACTTCAGTTCGCC
GAGGCCATTCAAGAGATTACGCGACGCTATGACAATCTGTTTGAATGTAGCTTCCCATACAGCTCAGGCATTCAT
CAGGCGCCACTCAAGGGCTCTGAGGAGGAAATGGAGTGCGCCTATTTTCACATGCACTTTTATCCACCGCTGCTG
CGGTCTGCCACTGTCAGGAAATTCCTTGTTGGCTATGAACTCATGGCTGAACCACAGCGTGACATTACCCCAGAG
CAGGCTACGGCGCGCCTGCGCGACTGTGGAGGAGAGTTGTATAGAAAAGGGCTCAAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail