Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5642
Gene name
LocationContig_45:99038..100685
Strand-
Gene length (bp)1647
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.5E-08 81 123
PF00569 ZZ Zinc finger, ZZ type 1.5E-08 18 59
PF04433 SWIRM SWIRM domain 6.9E-07 445 514

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 19 517 3.0E-129
sp|Q02336|ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADA2 PE=1 SV=1 18 514 2.0E-117
sp|Q9P7J7|ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ada2 PE=1 SV=1 18 357 4.0E-99
sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana GN=ADA2B PE=1 SV=1 12 512 2.0E-54
sp|Q3SZP8|TAD2A_BOVIN Transcriptional adapter 2-alpha OS=Bos taurus GN=TADA2A PE=2 SV=1 21 517 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 19 517 3.0E-129
sp|Q02336|ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADA2 PE=1 SV=1 18 514 2.0E-117
sp|Q9P7J7|ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ada2 PE=1 SV=1 18 357 4.0E-99
sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana GN=ADA2B PE=1 SV=1 12 512 2.0E-54
sp|Q3SZP8|TAD2A_BOVIN Transcriptional adapter 2-alpha OS=Bos taurus GN=TADA2A PE=2 SV=1 21 517 1.0E-44
sp|Q6AYE3|TAD2A_RAT Transcriptional adapter 2-alpha OS=Rattus norvegicus GN=Tada2a PE=2 SV=1 21 517 2.0E-43
sp|O75478|TAD2A_HUMAN Transcriptional adapter 2-alpha OS=Homo sapiens GN=TADA2A PE=1 SV=3 21 517 2.0E-43
sp|Q75LL6|TADA2_ORYSJ Transcriptional adapter ADA2 OS=Oryza sativa subsp. japonica GN=ADA2 PE=2 SV=2 19 508 4.0E-43
sp|Q8CHV6|TAD2A_MOUSE Transcriptional adapter 2-alpha OS=Mus musculus GN=Tada2a PE=1 SV=1 21 517 4.0E-43
sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidopsis thaliana GN=ADA2A PE=1 SV=1 19 512 2.0E-40
sp|Q5ZJF3|TAD2A_CHICK Transcriptional adapter 2-alpha OS=Gallus gallus GN=TADA2A PE=2 SV=1 6 517 3.0E-40
sp|Q5RBN9|TAD2B_PONAB Transcriptional adapter 2-beta OS=Pongo abelii GN=TADA2B PE=2 SV=1 13 367 6.0E-31
sp|Q86TJ2|TAD2B_HUMAN Transcriptional adapter 2-beta OS=Homo sapiens GN=TADA2B PE=1 SV=2 13 367 6.0E-31
sp|Q6NRB5|TAD2B_XENLA Transcriptional adapter 2-beta OS=Xenopus laevis GN=tada2b PE=2 SV=1 18 367 3.0E-30
sp|Q503N9|TAD2B_DANRE Transcriptional adapter 2-beta OS=Danio rerio GN=tada2b PE=2 SV=1 16 344 2.0E-23
sp|Q8I8V0|TAD2B_DROME Transcriptional adapter 2B OS=Drosophila melanogaster GN=Ada2b PE=1 SV=1 17 396 3.0E-22
sp|Q7KSD8|TAD2A_DROME Transcriptional adapter 2A OS=Drosophila melanogaster GN=Rpb4 PE=1 SV=1 21 516 8.0E-18
sp|P43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1 19 130 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5642
MGVIRKKTATRGGEGGVKYVCDVCSSDITSTVRIRCADPACSDFDLCVSCFAKGESRNAHDPATHAFRVIEQNSF
PIFDREWGADEELLLLEGAEIYGLGSWADIADHIGGFREKDEVRDHYLETYVNSSAFPLPQRCKPFDCDLANEVP
REEFQARKKRRIEQRRERAKNAPALQPKTKPTASVPSCHEIQGYMPGRLEFETEYANEAEEAVQNMQFDPGDGLN
PRTGELEPEMELKLTVMEIYNCRLTQRVERKKVIFEHDLLDYREHTKIEKKRSKEEKDLLQKAKPFARIMNHNDF
EDFNQGLIDELFLRQAIAQLQEWRNLCIGDLRSGEKYEQEKTQRLQKAVPMGSMDRERLASSQRSKQPPPPEAPS
GAALLVAPELVIRPAPQTSNGTIPGMTSKPTPNGTGQMVNGQNGHLRPRHLLQPLPGLVPLQLGPDNANDVQLLT
PEEAKLCEVVRLQPKPYLMIKDQILREALKSNGTLKRKQAKEICRLDPQKGSRIFDFFITAGWVGKA*
Coding >OphauB2|5642
ATGGGCGTCATTCGCAAAAAGACGGCCACGCGCGGCGGCGAGGGTGGTGTGAAATATGTTTGCGATGTTTGCTCG
TCAGACATTACATCGACAGTCCGCATTAGGTGTGCGGACCCGGCGTGTTCTGACTTTGACCTCTGCGTCTCCTGT
TTTGCCAAGGGCGAGTCTCGAAACGCGCACGATCCGGCGACACATGCTTTTCGCGTCATTGAGCAGAATTCCTTT
CCCATCTTTGACCGCGAATGGGGAGCCGACGAAGAGCTGTTGCTTCTCGAGGGCGCTGAGATTTATGGCCTAGGG
TCTTGGGCAGACATTGCAGATCACATTGGAGGCTTCCGCGAGAAGGACGAGGTTCGCGACCACTATCTCGAGACT
TATGTCAACTCGAGTGCCTTTCCCTTACCCCAACGGTGTAAACCTTTCGACTGCGACCTAGCCAACGAAGTTCCT
CGCGAAGAGTTCCAGGCGCGCAAAAAGCGCCGTATAGAGCAACGTCGCGAAAGAGCAAAGAATGCTCCGGCTCTG
CAGCCCAAAACGAAGCCGACGGCCAGTGTTCCCAGCTGCCACGAAATCCAAGGATATATGCCAGGGCGGCTTGAG
TTTGAGACGGAATACGCAAACGAAGCCGAGGAGGCAGTACAAAATATGCAGTTTGATCCAGGCGACGGCCTAAAC
CCGCGCACTGGCGAGCTCGAGCCCGAAATGGAGCTCAAGCTCACCGTAATGGAGATTTACAACTGCCGCCTTACC
CAGCGTGTCGAGCGCAAAAAGGTCATTTTTGAGCACGACTTGCTCGACTATCGAGAACACACTAAGATTGAAAAG
AAACGGAGCAAGGAAGAAAAAGACTTGCTGCAAAAGGCCAAGCCATTTGCACGAATCATGAACCACAACGACTTT
GAAGACTTCAACCAAGGTCTCATTGACGAGTTGTTTCTGAGGCAGGCCATTGCTCAGCTGCAGGAATGGCGCAAT
TTGTGCATTGGAGATTTGCGGAGCGGAGAAAAATATGAACAGGAAAAGACGCAACGCCTACAAAAGGCGGTTCCA
ATGGGCTCCATGGACCGCGAGCGTCTGGCGTCGAGTCAGCGGTCTAAACAACCGCCGCCTCCAGAGGCACCATCT
GGAGCCGCACTCTTGGTGGCGCCCGAGCTAGTCATCAGACCAGCTCCTCAGACGAGCAACGGCACCATACCTGGC
ATGACGAGTAAGCCCACGCCCAATGGTACCGGCCAAATGGTCAATGGACAAAACGGGCACTTGCGTCCCAGACAC
TTGCTGCAGCCTCTGCCAGGACTGGTTCCTCTGCAGCTTGGTCCTGATAACGCGAATGATGTTCAACTATTGACG
CCCGAAGAGGCCAAACTATGCGAGGTGGTTCGCCTTCAGCCAAAGCCATACCTCATGATCAAGGACCAGATTCTC
CGAGAAGCCCTCAAGTCCAACGGCACGTTGAAACGAAAACAGGCCAAGGAGATATGCCGGCTTGATCCCCAAAAG
GGTTCGCGCATCTTTGACTTTTTCATCACTGCAGGGTGGGTAGGTAAGGCCTAG
Transcript >OphauB2|5642
ATGGGCGTCATTCGCAAAAAGACGGCCACGCGCGGCGGCGAGGGTGGTGTGAAATATGTTTGCGATGTTTGCTCG
TCAGACATTACATCGACAGTCCGCATTAGGTGTGCGGACCCGGCGTGTTCTGACTTTGACCTCTGCGTCTCCTGT
TTTGCCAAGGGCGAGTCTCGAAACGCGCACGATCCGGCGACACATGCTTTTCGCGTCATTGAGCAGAATTCCTTT
CCCATCTTTGACCGCGAATGGGGAGCCGACGAAGAGCTGTTGCTTCTCGAGGGCGCTGAGATTTATGGCCTAGGG
TCTTGGGCAGACATTGCAGATCACATTGGAGGCTTCCGCGAGAAGGACGAGGTTCGCGACCACTATCTCGAGACT
TATGTCAACTCGAGTGCCTTTCCCTTACCCCAACGGTGTAAACCTTTCGACTGCGACCTAGCCAACGAAGTTCCT
CGCGAAGAGTTCCAGGCGCGCAAAAAGCGCCGTATAGAGCAACGTCGCGAAAGAGCAAAGAATGCTCCGGCTCTG
CAGCCCAAAACGAAGCCGACGGCCAGTGTTCCCAGCTGCCACGAAATCCAAGGATATATGCCAGGGCGGCTTGAG
TTTGAGACGGAATACGCAAACGAAGCCGAGGAGGCAGTACAAAATATGCAGTTTGATCCAGGCGACGGCCTAAAC
CCGCGCACTGGCGAGCTCGAGCCCGAAATGGAGCTCAAGCTCACCGTAATGGAGATTTACAACTGCCGCCTTACC
CAGCGTGTCGAGCGCAAAAAGGTCATTTTTGAGCACGACTTGCTCGACTATCGAGAACACACTAAGATTGAAAAG
AAACGGAGCAAGGAAGAAAAAGACTTGCTGCAAAAGGCCAAGCCATTTGCACGAATCATGAACCACAACGACTTT
GAAGACTTCAACCAAGGTCTCATTGACGAGTTGTTTCTGAGGCAGGCCATTGCTCAGCTGCAGGAATGGCGCAAT
TTGTGCATTGGAGATTTGCGGAGCGGAGAAAAATATGAACAGGAAAAGACGCAACGCCTACAAAAGGCGGTTCCA
ATGGGCTCCATGGACCGCGAGCGTCTGGCGTCGAGTCAGCGGTCTAAACAACCGCCGCCTCCAGAGGCACCATCT
GGAGCCGCACTCTTGGTGGCGCCCGAGCTAGTCATCAGACCAGCTCCTCAGACGAGCAACGGCACCATACCTGGC
ATGACGAGTAAGCCCACGCCCAATGGTACCGGCCAAATGGTCAATGGACAAAACGGGCACTTGCGTCCCAGACAC
TTGCTGCAGCCTCTGCCAGGACTGGTTCCTCTGCAGCTTGGTCCTGATAACGCGAATGATGTTCAACTATTGACG
CCCGAAGAGGCCAAACTATGCGAGGTGGTTCGCCTTCAGCCAAAGCCATACCTCATGATCAAGGACCAGATTCTC
CGAGAAGCCCTCAAGTCCAACGGCACGTTGAAACGAAAACAGGCCAAGGAGATATGCCGGCTTGATCCCCAAAAG
GGTTCGCGCATCTTTGACTTTTTCATCACTGCAGGGTGGGTAGGTAAGGCCTAG
Gene >OphauB2|5642
ATGGGCGTCATTCGCAAAAAGACGGCCACGCGCGGCGGCGAGGGTGGTGTGAAATATGTTTGCGATGTTTGCTCG
TCAGACATTACATCGACAGTAGGAGCTGCCTCTGCCCTCTGACTCTGCCCTCTGCCTCTGCCCTCTGCCTCTTGC
TGTCGCGTTTGTCAGCTGGCTGACAAGTGAACTCAGGTCCGCATTAGGTGTGCGGACCCGGCGTGTTCTGACTTT
GACCTCTGCGTCTCCTGTTTTGCCAAGGGCGAGTCTCGAAACGCGCACGATCCGGCGACACATGCTTTTCGCGTC
ATTGAGCAGAATTCCTTTCCCATCTTTGACCGCGAATGGGGAGCCGACGAAGAGCTGTTGCTTCTCGAGGGCGCT
GAGATTTATGGCCTAGGGTCTTGGGCAGACATTGCAGATCACATTGGAGGCTTCCGCGAGAAGGACGAGGTTCGC
GACCACTATCTCGAGACTTATGTCAACTCGAGTGCCTTTCCCTTACCCCAACGGTGTAAACCTTTCGACTGCGAC
CTAGCCAACGAAGTTCCTCGCGAAGAGTTCCAGGCGCGCAAAAAGCGCCGTATAGAGCAACGTCGCGAAAGAGCA
AAGAATGCTCCGGCTCTGCAGCCCAAAACGAAGCCGACGGCCAGTGTTCCCAGCTGCCACGAAATCCAAGGATAT
ATGCCAGGGCGGCTTGAGTTTGAGACGGAATACGCAAACGAAGCCGAGGAGGCAGTACAAAATATGCAGTTTGAT
CCAGGCGACGGCCTAAACCCGCGCACTGGCGAGCTCGAGCCCGAAATGGAGCTCAAGCTCACCGTAATGGAGATT
TACAACTGCCGCCTTACCCAGCGTGTCGAGCGCAAAAAGGTCATTTTTGAGCACGACTTGCTCGACTATCGAGAA
CACACTAAGATTGAAAAGAAACGGAGCAAGGAAGAAAAAGACTTGCTGCAAAAGGCCAAGCCATTTGCACGAATC
ATGAACCACAACGACTTTGAAGACTTCAACCAAGGTCTCATTGACGAGTTGTTTCTGAGGCAGGCCATTGCTCAG
CTGCAGGAATGGCGCAATTTGTGCATTGGAGATTTGCGGAGCGGAGAAAAATATGAACAGGAAAAGACGCAACGC
CTACAAAAGGCGGTTCCAATGGGCTCCATGGACCGCGAGCGTCTGGCGTCGAGTCAGCGGTCTAAACAACCGCCG
CCTCCAGAGGCACCATCTGGAGCCGCACTCTTGGTGGCGCCCGAGCTAGTCATCAGACCAGCTCCTCAGACGAGC
AACGGCACCATACCTGGCATGACGAGTAAGCCCACGCCCAATGGTACCGGCCAAATGGTCAATGGACAAAACGGG
CACTTGCGTCCCAGACACTTGCTGCAGCCTCTGCCAGGACTGGTTCCTCTGCAGCTTGGTCCTGATAACGCGAAT
GATGTTCAACTATTGACGCCCGAAGAGGCCAAACTATGCGAGGTGGTTCGCCTTCAGCCAAAGCCATACCTCATG
ATCAAGGACCAGATTCTCCGAGAAGCCCTCAAGTCCAACGGCACGTTGAAACGAAAACAGGCCAAGGAGATATGC
CGGCTTGATCCCCAAAAGGGTTCGCGCATCTTTGACTTTTTCATCACTGCAGGGTGGGTAGGTAAGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail