Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5636
Gene name
LocationContig_45:80332..84195
Strand+
Gene length (bp)3863
Transcript length (bp)3324
Coding sequence length (bp)3324
Protein length (aa) 1108

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 7.6E-59 726 901
PF08242 Methyltransf_12 Methyltransferase domain 6.2E-21 4 109
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 3.7E-18 564 701
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.5E-13 526 644
PF13649 Methyltransf_25 Methyltransferase domain 1.4E-10 3 107
PF13489 Methyltransf_23 Methyltransferase domain 4.3E-10 2 161
PF08241 Methyltransf_11 Methyltransferase domain 1.2E-09 4 110
PF13847 Methyltransf_31 Methyltransferase domain 7.0E-10 1 115
PF00106 adh_short short chain dehydrogenase 7.5E-07 729 883
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.0E-04 407 463

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 2 1092 8.0E-142
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 370 916 7.0E-83
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 370 916 7.0E-83
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 375 906 6.0E-65
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 416 906 3.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 2 1092 8.0E-142
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 370 916 7.0E-83
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 370 916 7.0E-83
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 375 906 6.0E-65
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 416 906 3.0E-64
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 345 942 3.0E-61
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 391 906 3.0E-61
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 458 910 8.0E-60
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 388 904 3.0E-59
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 416 907 5.0E-59
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 401 899 2.0E-58
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 369 904 2.0E-56
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1 908 4.0E-55
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 32 906 4.0E-55
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 419 1087 2.0E-54
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 419 1087 3.0E-54
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 377 910 3.0E-53
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 419 909 3.0E-53
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 377 910 3.0E-53
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 377 910 3.0E-53
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 377 910 3.0E-53
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 377 910 3.0E-53
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 43 910 3.0E-51
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 395 1106 2.0E-49
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1 908 1.0E-48
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 4 1105 3.0E-46
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 395 898 1.0E-45
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 296 1102 2.0E-45
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 4 1095 9.0E-45
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 296 908 2.0E-44
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 346 1099 2.0E-44
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 401 898 3.0E-44
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 296 908 3.0E-44
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 307 908 4.0E-44
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 4 1094 6.0E-44
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 346 908 9.0E-44
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 346 1084 1.0E-43
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 346 908 1.0E-43
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 395 908 2.0E-43
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 4 1094 6.0E-43
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 395 1084 5.0E-42
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 395 908 9.0E-42
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 395 908 1.0E-41
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 310 1095 1.0E-41
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 346 908 3.0E-41
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 318 910 6.0E-40
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 209 910 1.0E-38
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 369 3.0E-36
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 355 1094 1.0E-34
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 404 1090 4.0E-34
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 77 950 8.0E-34
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 408 701 6.0E-33
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 404 1090 2.0E-32
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 695 1102 3.0E-32
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 404 896 3.0E-31
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 404 896 1.0E-29
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 187 3.0E-29
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 187 4.0E-29
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 395 908 6.0E-29
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 408 701 1.0E-27
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 456 701 1.0E-27
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 395 702 3.0E-27
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 676 1089 5.0E-27
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 676 1089 9.0E-27
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 744 1105 1.0E-26
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 404 702 5.0E-24
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 408 660 8.0E-23
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 387 704 3.0E-22
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 408 707 2.0E-21
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 408 707 2.0E-21
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 407 660 5.0E-21
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 403 698 6.0E-21
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 744 904 3.0E-20
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 744 904 3.0E-20
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 744 904 3.0E-20
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 724 887 7.0E-19
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 720 935 5.0E-18
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 720 935 5.0E-18
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 720 935 5.0E-18
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1 161 7.0E-18
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 724 925 1.0E-17
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 407 686 2.0E-17
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 405 701 2.0E-17
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 438 701 3.0E-17
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 438 618 5.0E-17
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 727 914 5.0E-17
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 727 914 5.0E-17
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 727 914 5.0E-17
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 719 885 8.0E-17
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 438 618 1.0E-16
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 381 669 5.0E-16
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 408 618 6.0E-16
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1 185 1.0E-15
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 408 686 3.0E-15
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1 175 4.0E-15
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 438 645 5.0E-15
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 726 973 7.0E-15
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 438 645 3.0E-14
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 725 899 5.0E-14
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 726 889 6.0E-14
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 724 925 2.0E-13
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 402 703 2.0E-13
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 724 944 9.0E-13
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 409 703 1.0E-12
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 741 898 2.0E-12
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 392 656 6.0E-12
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 402 702 7.0E-12
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 671 943 3.0E-11
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 722 904 3.0E-11
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 744 899 3.0E-11
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 744 899 3.0E-11
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 729 874 8.0E-11
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 405 711 6.0E-10
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 408 703 1.0E-09
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1 173 2.0E-09
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1 173 4.0E-09
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 782 894 4.0E-09
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 407 703 4.0E-09
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1 173 6.0E-09
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1 173 7.0E-09
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 729 873 8.0E-09
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 729 873 8.0E-09
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1 173 9.0E-09
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 725 873 9.0E-09
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 725 873 9.0E-09
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 725 873 9.0E-09
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 725 873 9.0E-09
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 725 873 9.0E-09
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 725 873 9.0E-09
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1 134 1.0E-08
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 407 706 1.0E-08
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1 173 2.0E-08
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 770 894 2.0E-08
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 404 703 2.0E-08
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1 152 3.0E-08
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 386 633 5.0E-08
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 402 703 9.0E-08
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1 173 1.0E-07
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 729 883 1.0E-07
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 407 703 1.0E-07
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 407 703 1.0E-07
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1 171 2.0E-07
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 729 874 2.0E-07
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 416 616 3.0E-07
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 386 633 3.0E-07
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 170 4.0E-07
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 708 893 4.0E-07
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 405 709 6.0E-07
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 403 704 7.0E-07
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 458 709 7.0E-07
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1 173 1.0E-06
sp|P96825|Y0148_MYCTU Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0148 PE=1 SV=3 729 874 1.0E-06
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 729 881 6.0E-06
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 729 881 6.0E-06
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 4 167 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5636
MRVLEIGAGTGSFTSNMLPALVDKRGTRMYSKYIFTDISSAFFPAAGKKFNKYSGLEFQTLDITVDPAQQGFELG
SYDVILASNVLHATPCLQQTLRNVRRLLRSGGVLFLDEVTDDALWNSFRFIVGFLPGWWLGGDDGRISSPLVSTQ
RWCAELSEAGFCKPTVMLDDDNVDLHCTAQIIVTASDEERNDFTPDSEVERITLLYHEEKHPFACKLADALVQAG
FSVEWSRLGHDEAITDHDVIATMDLEKPFLHDITASEYEGLMKQISQLQSGMIWLTRPAQVHCQDPRYGLVMGLA
RTVRLELLVDFTTIELQDLDPASVASVVAILAKVQRQRNEGKDHGEAEFAIHDGVVLTGRYHWSQCKEELEDNGL
SQDSPLQLTCGSPPSVDSLYWLQHEEQTLGGDEVEVEMRCASLNFKDVAISMGLLSIENNSMGADGAGIVRRVGH
KVDHVRPGDRVMILGQGTFTNRLTFPGRQVQAIPPQLSFEDAAAMASVFMTVIYAVINVGQLAKGQSILIHSACG
GVGMAALQLCRMIQADIYVTVGNEDKVNHLVDAHQVPRDRIFNSRNTSFVKDIMRATGGRGVDLVLNSLSGELLY
ASWSCVAPGGKMLELGKRDLRARGHLSLELFEDNRSFHGIFMPGLYVQRPSLYMTMLQQLMGYYKDGHIGPIRPV
EIFPASRIADAMHYMQQGRHMGKIVISIPTDLSTTVPIVKTQNRITLSDTGCYLVVGGISGLGKSITTWMVERGA
RNFVFLSPSAGKRDEDQLFLRELESQACRAVAVAGSAAEMSHVQQAIKMAPAPIVGVLQLAMVLRDALISNMTFD
DWNAVLQPKVKGTWNLHEAFAEAQLDFFLLFSSVCGVCGNPGQANYAAAGSFLDSFVQYRRAHGLPCSIIDLGIM
RDVGYINKYKHKLGLEKGFRAIYEGDLVTAVELAICSSPVNQSKALDFGYCSTAQLAIGLDWVSFSKSQSFRRLD
ARMSLTEEPRTSDFDSDAHGNERVLKDLLASAASRPECLEEASNFEILTTEIGRAICKLMMWSFEDFDMTQNLST
KIDSLVSIEIRTWWRRNLGIEVSVLQLMSQGTVEAMARLAIKLLRVRLGKVDDSNVF*
Coding >OphauB2|5636
ATGCGCGTCCTAGAAATCGGAGCAGGCACAGGAAGCTTCACGAGCAACATGCTGCCAGCGCTGGTAGACAAGCGC
GGCACCCGCATGTATTCAAAGTACATCTTTACCGACATTTCCTCTGCCTTTTTCCCCGCAGCCGGGAAAAAATTC
AACAAGTATTCAGGACTGGAATTCCAGACTCTCGACATCACCGTGGACCCCGCACAACAGGGCTTTGAACTGGGC
TCGTATGATGTTATTTTGGCTTCGAATGTGTTGCATGCCACGCCATGCCTGCAGCAAACGCTTCGAAATGTGCGT
CGACTGCTGCGCAGTGGCGGAGTCTTGTTTCTCGATGAAGTCACAGACGACGCGTTGTGGAATAGTTTTCGGTTT
ATAGTTGGTTTCTTGCCTGGATGGTGGCTTGGTGGTGACGACGGCCGAATCTCTTCGCCATTGGTATCGACTCAA
AGATGGTGTGCGGAGCTTAGCGAGGCAGGATTTTGCAAACCAACCGTCATGCTGGACGATGACAACGTTGACTTG
CACTGCACGGCTCAAATCATTGTCACAGCCAGCGACGAGGAACGAAACGATTTCACCCCGGATAGCGAGGTGGAG
CGGATTACGCTCTTGTATCATGAGGAGAAGCACCCCTTTGCCTGCAAACTGGCCGACGCCCTGGTGCAAGCCGGC
TTCAGCGTTGAGTGGAGCCGGCTGGGCCATGACGAGGCAATTACAGACCACGACGTTATTGCCACCATGGACCTG
GAAAAGCCCTTTCTCCACGATATTACGGCCAGCGAATACGAAGGCTTGATGAAGCAAATCTCCCAGCTGCAGAGC
GGGATGATTTGGCTGACGCGGCCGGCTCAGGTGCACTGTCAGGACCCTCGCTACGGCCTGGTCATGGGGCTTGCT
CGCACGGTACGCTTGGAGCTCTTGGTCGATTTTACTACGATTGAGCTGCAAGACTTGGACCCTGCAAGCGTAGCT
AGCGTGGTAGCCATCCTAGCCAAGGTGCAACGCCAAAGAAATGAGGGCAAGGACCATGGCGAGGCCGAGTTTGCT
ATACACGATGGCGTCGTCTTGACGGGGCGATACCACTGGAGCCAGTGCAAAGAAGAGCTCGAGGACAACGGCTTG
TCTCAAGACTCTCCCCTGCAACTCACCTGTGGCAGCCCGCCGTCGGTTGACTCACTTTACTGGCTGCAGCACGAG
GAGCAGACATTGGGTGGTGACGAGGTCGAGGTGGAGATGCGCTGCGCCTCACTCAACTTCAAGGACGTGGCCATC
TCCATGGGCCTCTTGAGCATAGAAAACAATTCAATGGGCGCGGACGGGGCGGGCATTGTTCGACGTGTGGGACAC
AAAGTCGACCATGTCCGGCCCGGCGATAGAGTCATGATTCTGGGTCAAGGCACATTCACCAACCGCTTAACATTT
CCTGGGAGGCAGGTGCAGGCAATCCCGCCGCAGCTGAGCTTTGAGGATGCGGCAGCCATGGCCAGCGTCTTCATG
ACCGTCATTTACGCCGTCATCAATGTAGGGCAGTTGGCCAAGGGGCAGTCCATCTTGATCCATTCAGCCTGCGGA
GGCGTGGGAATGGCGGCTCTGCAGCTCTGCCGCATGATACAGGCCGACATTTACGTCACCGTGGGCAACGAGGAC
AAGGTCAACCACCTGGTCGACGCTCATCAGGTGCCACGAGACCGCATCTTTAACTCACGCAACACGTCTTTTGTC
AAGGACATTATGCGAGCCACGGGCGGCCGTGGCGTCGACTTGGTGCTCAACTCGCTCTCGGGCGAGCTGCTCTAT
GCGTCGTGGTCCTGTGTTGCTCCAGGTGGCAAAATGCTGGAGCTAGGAAAACGTGATTTACGGGCCCGCGGCCAT
CTCTCTCTGGAGCTCTTTGAGGACAATCGCTCATTTCACGGCATTTTTATGCCAGGCCTTTATGTACAACGACCA
AGTCTTTATATGACGATGCTGCAACAGTTGATGGGCTATTACAAAGACGGCCACATTGGCCCAATCCGTCCCGTC
GAAATCTTTCCAGCCTCGCGCATCGCCGATGCCATGCATTATATGCAACAAGGCCGACACATGGGCAAGATTGTC
ATCTCTATTCCCACAGACTTGTCCACGACAGTCCCCATTGTCAAGACACAAAATCGCATCACTCTGTCGGACACG
GGATGCTACCTTGTAGTCGGCGGCATTTCCGGCCTCGGCAAGTCCATCACCACCTGGATGGTGGAACGTGGCGCC
CGAAACTTTGTCTTTCTCTCACCCTCTGCCGGCAAGCGAGACGAGGACCAGCTCTTTTTGCGCGAGCTCGAGTCG
CAGGCCTGTCGTGCTGTTGCGGTTGCTGGCAGCGCTGCCGAAATGTCTCATGTGCAGCAGGCCATTAAAATGGCG
CCAGCACCCATTGTTGGGGTCTTGCAATTGGCCATGGTTTTACGGGATGCTCTTATTTCAAACATGACTTTTGAC
GACTGGAATGCCGTGCTGCAACCCAAAGTCAAGGGGACATGGAACCTACACGAGGCCTTTGCCGAAGCCCAACTC
GATTTTTTCCTCCTCTTCAGCTCCGTCTGCGGCGTCTGCGGCAACCCGGGACAAGCAAACTATGCAGCAGCCGGC
TCCTTTTTAGACTCCTTTGTGCAGTATCGGCGTGCACATGGCCTGCCCTGTTCTATAATCGACCTTGGCATCATG
CGCGACGTTGGCTACATAAACAAGTATAAACATAAACTGGGGCTGGAAAAGGGCTTCCGTGCCATCTACGAAGGG
GACCTTGTTACCGCCGTCGAGCTTGCCATTTGCTCTTCTCCAGTCAATCAGTCCAAAGCGCTTGACTTTGGATAC
TGCAGCACGGCCCAGCTGGCCATTGGCCTGGACTGGGTATCCTTTTCCAAGTCTCAGTCCTTTAGAAGACTAGAT
GCGCGAATGTCCTTGACGGAGGAGCCAAGAACGTCGGATTTCGACTCAGACGCGCATGGTAATGAAAGAGTGCTC
AAAGACTTGCTCGCCTCGGCTGCCTCTAGGCCTGAATGCTTGGAGGAGGCTAGTAATTTTGAAATACTCACTACT
GAGATTGGCCGCGCTATTTGCAAGTTGATGATGTGGTCGTTTGAGGACTTTGACATGACGCAGAACCTCTCCACC
AAGATTGACTCACTCGTCAGTATTGAAATTCGCACCTGGTGGCGGCGCAATCTTGGCATCGAGGTTAGTGTTTTG
CAGCTTATGAGCCAGGGAACTGTTGAGGCAATGGCCCGCTTGGCTATTAAGCTGCTGCGTGTCAGGCTTGGCAAA
GTCGATGATTCAAATGTTTTTTGA
Transcript >OphauB2|5636
ATGCGCGTCCTAGAAATCGGAGCAGGCACAGGAAGCTTCACGAGCAACATGCTGCCAGCGCTGGTAGACAAGCGC
GGCACCCGCATGTATTCAAAGTACATCTTTACCGACATTTCCTCTGCCTTTTTCCCCGCAGCCGGGAAAAAATTC
AACAAGTATTCAGGACTGGAATTCCAGACTCTCGACATCACCGTGGACCCCGCACAACAGGGCTTTGAACTGGGC
TCGTATGATGTTATTTTGGCTTCGAATGTGTTGCATGCCACGCCATGCCTGCAGCAAACGCTTCGAAATGTGCGT
CGACTGCTGCGCAGTGGCGGAGTCTTGTTTCTCGATGAAGTCACAGACGACGCGTTGTGGAATAGTTTTCGGTTT
ATAGTTGGTTTCTTGCCTGGATGGTGGCTTGGTGGTGACGACGGCCGAATCTCTTCGCCATTGGTATCGACTCAA
AGATGGTGTGCGGAGCTTAGCGAGGCAGGATTTTGCAAACCAACCGTCATGCTGGACGATGACAACGTTGACTTG
CACTGCACGGCTCAAATCATTGTCACAGCCAGCGACGAGGAACGAAACGATTTCACCCCGGATAGCGAGGTGGAG
CGGATTACGCTCTTGTATCATGAGGAGAAGCACCCCTTTGCCTGCAAACTGGCCGACGCCCTGGTGCAAGCCGGC
TTCAGCGTTGAGTGGAGCCGGCTGGGCCATGACGAGGCAATTACAGACCACGACGTTATTGCCACCATGGACCTG
GAAAAGCCCTTTCTCCACGATATTACGGCCAGCGAATACGAAGGCTTGATGAAGCAAATCTCCCAGCTGCAGAGC
GGGATGATTTGGCTGACGCGGCCGGCTCAGGTGCACTGTCAGGACCCTCGCTACGGCCTGGTCATGGGGCTTGCT
CGCACGGTACGCTTGGAGCTCTTGGTCGATTTTACTACGATTGAGCTGCAAGACTTGGACCCTGCAAGCGTAGCT
AGCGTGGTAGCCATCCTAGCCAAGGTGCAACGCCAAAGAAATGAGGGCAAGGACCATGGCGAGGCCGAGTTTGCT
ATACACGATGGCGTCGTCTTGACGGGGCGATACCACTGGAGCCAGTGCAAAGAAGAGCTCGAGGACAACGGCTTG
TCTCAAGACTCTCCCCTGCAACTCACCTGTGGCAGCCCGCCGTCGGTTGACTCACTTTACTGGCTGCAGCACGAG
GAGCAGACATTGGGTGGTGACGAGGTCGAGGTGGAGATGCGCTGCGCCTCACTCAACTTCAAGGACGTGGCCATC
TCCATGGGCCTCTTGAGCATAGAAAACAATTCAATGGGCGCGGACGGGGCGGGCATTGTTCGACGTGTGGGACAC
AAAGTCGACCATGTCCGGCCCGGCGATAGAGTCATGATTCTGGGTCAAGGCACATTCACCAACCGCTTAACATTT
CCTGGGAGGCAGGTGCAGGCAATCCCGCCGCAGCTGAGCTTTGAGGATGCGGCAGCCATGGCCAGCGTCTTCATG
ACCGTCATTTACGCCGTCATCAATGTAGGGCAGTTGGCCAAGGGGCAGTCCATCTTGATCCATTCAGCCTGCGGA
GGCGTGGGAATGGCGGCTCTGCAGCTCTGCCGCATGATACAGGCCGACATTTACGTCACCGTGGGCAACGAGGAC
AAGGTCAACCACCTGGTCGACGCTCATCAGGTGCCACGAGACCGCATCTTTAACTCACGCAACACGTCTTTTGTC
AAGGACATTATGCGAGCCACGGGCGGCCGTGGCGTCGACTTGGTGCTCAACTCGCTCTCGGGCGAGCTGCTCTAT
GCGTCGTGGTCCTGTGTTGCTCCAGGTGGCAAAATGCTGGAGCTAGGAAAACGTGATTTACGGGCCCGCGGCCAT
CTCTCTCTGGAGCTCTTTGAGGACAATCGCTCATTTCACGGCATTTTTATGCCAGGCCTTTATGTACAACGACCA
AGTCTTTATATGACGATGCTGCAACAGTTGATGGGCTATTACAAAGACGGCCACATTGGCCCAATCCGTCCCGTC
GAAATCTTTCCAGCCTCGCGCATCGCCGATGCCATGCATTATATGCAACAAGGCCGACACATGGGCAAGATTGTC
ATCTCTATTCCCACAGACTTGTCCACGACAGTCCCCATTGTCAAGACACAAAATCGCATCACTCTGTCGGACACG
GGATGCTACCTTGTAGTCGGCGGCATTTCCGGCCTCGGCAAGTCCATCACCACCTGGATGGTGGAACGTGGCGCC
CGAAACTTTGTCTTTCTCTCACCCTCTGCCGGCAAGCGAGACGAGGACCAGCTCTTTTTGCGCGAGCTCGAGTCG
CAGGCCTGTCGTGCTGTTGCGGTTGCTGGCAGCGCTGCCGAAATGTCTCATGTGCAGCAGGCCATTAAAATGGCG
CCAGCACCCATTGTTGGGGTCTTGCAATTGGCCATGGTTTTACGGGATGCTCTTATTTCAAACATGACTTTTGAC
GACTGGAATGCCGTGCTGCAACCCAAAGTCAAGGGGACATGGAACCTACACGAGGCCTTTGCCGAAGCCCAACTC
GATTTTTTCCTCCTCTTCAGCTCCGTCTGCGGCGTCTGCGGCAACCCGGGACAAGCAAACTATGCAGCAGCCGGC
TCCTTTTTAGACTCCTTTGTGCAGTATCGGCGTGCACATGGCCTGCCCTGTTCTATAATCGACCTTGGCATCATG
CGCGACGTTGGCTACATAAACAAGTATAAACATAAACTGGGGCTGGAAAAGGGCTTCCGTGCCATCTACGAAGGG
GACCTTGTTACCGCCGTCGAGCTTGCCATTTGCTCTTCTCCAGTCAATCAGTCCAAAGCGCTTGACTTTGGATAC
TGCAGCACGGCCCAGCTGGCCATTGGCCTGGACTGGGTATCCTTTTCCAAGTCTCAGTCCTTTAGAAGACTAGAT
GCGCGAATGTCCTTGACGGAGGAGCCAAGAACGTCGGATTTCGACTCAGACGCGCATGGTAATGAAAGAGTGCTC
AAAGACTTGCTCGCCTCGGCTGCCTCTAGGCCTGAATGCTTGGAGGAGGCTAGTAATTTTGAAATACTCACTACT
GAGATTGGCCGCGCTATTTGCAAGTTGATGATGTGGTCGTTTGAGGACTTTGACATGACGCAGAACCTCTCCACC
AAGATTGACTCACTCGTCAGTATTGAAATTCGCACCTGGTGGCGGCGCAATCTTGGCATCGAGGTTAGTGTTTTG
CAGCTTATGAGCCAGGGAACTGTTGAGGCAATGGCCCGCTTGGCTATTAAGCTGCTGCGTGTCAGGCTTGGCAAA
GTCGATGATTCAAATGTTTTTTGA
Gene >OphauB2|5636
ATGCGCGTCCTAGAAATCGGAGCAGGCACAGGAAGCTTCACGAGCAACATGCTGCCAGCGCTGGTAGACAAGCGC
GGCACCCGCATGTATTCAAAGTACATCTTTACCGACATTTCCTCTGCCTTTTTCCCCGCAGCCGGGAAAAAATTC
AACAAGTATTCAGGACTGGAATTCCAGACTCTCGACATCACCGTGGACCCCGCACAACAGGGCTTTGAACTGGGC
TCGTATGATGTTATTTTGGCTTCGAATGTGCGTGTCTTGGTAAATCACCGTTGGGATTGCTGATACAACATGGCT
GACTTGTCAGGTGTTGCATGCCACGCCATGCCTGCAGCAAACGCTTCGAAATGTGCGTCGACTGCTGCGCAGTGG
CGGAGTCTTGTTTCTCGATGAAGTCACAGACGGTAAAGAATTCTGCTTCTGCTTCTGCTTCTGCTTCTTCCTCCA
GACATTCAAAGGATAAAAACTAATGCTTTTACACAGACGCGTTGTGGAATAGTTTTCGGTTTATAGTTGTAAGTC
GTTCAGTATTATGCCAGGGACCCCCGAGGTGTCTTTGAGTTTTTCTGACCCTTGATACCCATGGCAGGGTTTCTT
GCCTGGATGGTGGCTTGGTGGTGACGACGGCCGAATCTCTTCGCCATTGGTATCGACTCAAAGATGGTGTGCGGA
GCTTAGCGAGGCAGGATTTTGCAAACCAACCGTCATGCTGGACGATGACAACGTTGACTTGCACTGCACGGCTCA
AATCATTGTCACAGCCAGCGACGAGGAACGAAACGATTTCACCCCGGATAGCGAGGTGGAGCGGATTACGCTCTT
GTATCATGAGGAGAAGCACCCCTTTGCCTGCAAACTGGCCGACGCCCTGGTGCAAGCCGGCTTCAGCGTTGAGTG
GAGCCGGCTGGGCCATGACGAGGCAATTACAGACCACGACGTTATTGCCACCATGGACCTGGAAAAGCCCTTTCT
CCACGATATTACGGCCAGCGAATACGAAGGCTTGATGAAGCAAATCTCCCAGCTGCAGAGCGGGATGATTTGGCT
GACGCGGCCGGCTCAGGTGCACTGTCAGGACCCTCGCTACGGCCTGGTCATGGGGCTTGCTCGCACGGTACGCTT
GGAGCTCTTGGTCGATTTTACTACGATTGAGCTGCAAGACTTGGACCCTGCAAGCGTAGCTAGCGTGGTAGCCAT
CCTAGCCAAGGTGCAACGCCAAAGAAATGAGGGCAAGGACCATGGCGAGGCCGAGTTTGCTATACACGATGGCGT
CGTCTTGACGGGGCGATACCACTGGAGCCAGTGCAAAGAAGAGCTCGAGGACAACGGCTTGTCTCAAGACTCTCC
CCTGCAACTCACCTGTGGCAGCCCGCCGTCGGTTGACTCACTTTACTGGCTGCAGCACGAGGAGCAGACATTGGG
TGGTGACGAGGTCGAGGTGGAGATGCGCTGCGCCTCACTCAACTTCAAGGTATGAAGTGCGGCACCAAGTGCAGC
GTGGGAAATTTTGCTCACCATTTTTACACTTTTGCTAGGACGTGGCCATCTCCATGGGCCTCTTGAGCATAGAAA
ACAATTCAATGGGCGCGGACGGGGCGGGCATTGTTCGACGTGTGGGACACAAAGTCGACCATGTCCGGCCCGGCG
ATAGAGTCATGATTCTGGGTCAAGGCACATTCACCAACCGCTTAACATTTCCTGGGAGGCAGGTGCAGGCAATCC
CGCCGCAGCTGAGCTTTGAGGATGCGGCAGCCATGGCCAGCGTCTTCATGACCGTCATTTACGCCGTCATCAATG
TAGGGCAGTTGGCCAAGGGGCAGTCCATCTTGATCCATTCAGCCTGCGGAGGCGTGGGAATGGCGGCTCTGCAGC
TCTGCCGCATGATACAGGCCGACATTTACGTCACCGTGGGCAACGAGGACAAGGTCAACCACCTGGTCGACGCTC
ATCAGGTGCCACGAGACCGCATCTTTAACTCACGCAACACGTCTTTTGTCAAGGACATTATGCGAGCCACGGGCG
GCCGTGGCGTCGACTTGGTGCTCAACTCGCTCTCGGGCGAGCTGCTCTATGCGTCGTGGTCCTGTGTTGCTCCAG
GTGGCAAAATGCTGGAGCTAGGAAAACGTGATTTACGGGCCCGCGGCCATCTCTCTCTGGAGCTCTTTGAGGACA
ATCGCTCATTTCACGGCATTTTTATGCCAGGCCTTTATGTACAACGACCAAGTCTTTATATGACGTAAGACGGCC
CGCCCCTATTTTGTTTGTTCCTCATGCTGATAAGACGCCTCGCTTGCTACTCAGGATGCTGCAACAGTTGATGGG
CTATTACAAAGACGGCCACATTGGCCCAATCCGTCCCGTCGAAATCTTTCCAGCCTCGCGCATCGCCGATGCCAT
GCATTATATGCAACAAGGCCGACACATGGGCAAGATTGTCATCTCTATTCCCACAGACTTGTCCACGACAGTCCC
CATTGTCAAGACACAAAATCGCATCACTCTGTCGGACACGGGATGCTACCTTGTAGTCGGCGGCATTTCCGGCCT
CGGCAAGTCCATCACCACCTGGATGGTGGAACGTGGCGCCCGAAACTTTGTCTTTCTCTCACCCTCTGCCGGCAA
GCGAGACGAGGACCAGCTCTTTTTGCGCGAGCTCGAGTCGCAGGCCTGTCGTGCTGTTGCGGTTGCTGGCAGCGC
TGCCGAAATGTCTCATGTGCAGCAGGCCATTAAAATGGCGCCAGCACCCATTGTTGGGGTCTTGCAATTGGCCAT
GGTTTTACGGGCACGTATACCCCCTGGCTTTCTTTTTAAAGACAAACCTCCTTTCTCCCCTCGTCGCCAAGCCCT
CTTGTTCCTTTGAGTAAAAAAAAGGATGAAGAAGAAAAAATTGAGGAACAGAAATAGGGCGAGGTCAAAGGGGTA
CAAGGAATGAATGAGTACAGGACCAAGAGAAAGCAAGACAGAGACTAACATGTGGCTAGGATGCTCTTATTTCAA
ACATGACTTTTGACGACTGGAATGCCGTGCTGCAACCCAAAGTCAAGGGGACATGGAACCTACACGAGGCCTTTG
CCGAAGCCCAACTCGATTTTTTCCTCCTCTTCAGCTCCGTCTGCGGCGTCTGCGGCAACCCGGGACAAGCAAACT
ATGCAGCAGCCGGCTCCTTTTTAGACTCCTTTGTGCAGTATCGGCGTGCACATGGCCTGCCCTGTTCTATAATCG
ACCTTGGCATCATGCGCGACGTTGGCTACATAAACAAGTATAAACATAAACTGGGGCTGGAAAAGGGCTTCCGTG
CCATCTACGAAGGGGACCTTGTTACCGCCGTCGAGCTTGCCATTTGCTCTTCTCCAGTCAATCAGTCCAAAGCGC
TTGACTTTGGATACTGCAGCACGGCCCAGCTGGCCATTGGCCTGGACTGGGTATCCTTTTCCAAGTCTCAGTCCT
TTAGAAGACTAGATGCGCGAATGTCCTTGACGGAGGAGCCAAGAACGTCGGATTTCGACTCAGACGCGCATGGTA
ATGAAAGAGTGCTCAAAGACTTGCTCGCCTCGGCTGCCTCTAGGCCTGAATGCTTGGAGGAGGCTAGTAATTTTG
AAATACTCACTACTGAGATTGGCCGCGCTATTTGCAAGTTGATGATGTGGTCGTTTGAGGACTTTGACATGACGC
AGAACCTCTCCACCAAGATTGACTCACTCGTCAGTATTGAAATTCGCACCTGGTGGCGGCGCAATCTTGGCATCG
AGGTTAGTGTTTTGCAGCTTATGAGCCAGGGAACTGTTGAGGCAATGGCCCGCTTGGCTATTAAGCTGCTGCGTG
TCAGGCTTGGCAAAGTCGATGATTCAAATGTTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail