Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5635
Gene name
LocationContig_45:76595..78836
Strand+
Gene length (bp)2241
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00698 Acyl_transf_1 Acyl transferase domain 1.3E-49 310 591
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.2E-35 53 165
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 2.6E-21 168 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 3 591 7.0E-92
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 6 591 3.0E-91
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 6 591 3.0E-91
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 6 591 9.0E-91
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 5 590 7.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 3 591 7.0E-92
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 6 591 3.0E-91
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 6 591 3.0E-91
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 6 591 9.0E-91
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 5 590 7.0E-83
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 4 592 7.0E-82
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 3 590 2.0E-75
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 5 590 8.0E-74
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 3 590 2.0E-73
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 3 587 2.0E-73
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 2 596 5.0E-73
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 4 590 6.0E-73
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 2 597 1.0E-72
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 3 596 4.0E-72
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 573 6.0E-72
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 5 590 2.0E-71
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 5 590 2.0E-71
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 5 590 2.0E-71
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 2 594 3.0E-70
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 9 590 3.0E-70
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 2 594 3.0E-70
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 9 590 5.0E-70
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 2 594 1.0E-69
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 12 587 2.0E-68
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 2 590 2.0E-68
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 9 590 5.0E-68
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 2 594 2.0E-67
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 4 590 7.0E-67
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 6 590 7.0E-65
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 5 586 2.0E-64
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 5 590 3.0E-64
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 5 590 3.0E-64
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 5 590 3.0E-64
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 15 590 1.0E-63
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 6 590 1.0E-63
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 6 590 1.0E-63
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1 587 2.0E-63
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 5 590 3.0E-63
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 10 590 4.0E-63
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 10 590 4.0E-63
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 10 590 5.0E-63
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 5 590 5.0E-63
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 14 590 5.0E-63
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 10 591 5.0E-62
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 10 590 6.0E-62
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 9 590 8.0E-62
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 9 590 8.0E-62
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 9 590 8.0E-62
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 9 590 8.0E-62
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 9 590 1.0E-61
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 5 590 1.0E-61
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 6 591 2.0E-61
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 14 590 2.0E-61
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 15 590 9.0E-61
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 15 590 3.0E-60
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 6 590 4.0E-60
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 15 590 4.0E-60
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 6 591 7.0E-60
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 15 590 1.0E-59
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 10 590 2.0E-59
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 6 590 2.0E-59
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 15 590 3.0E-59
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 6 591 2.0E-58
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 15 590 2.0E-58
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 10 590 5.0E-58
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 10 588 9.0E-58
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 6 591 1.0E-57
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 10 590 2.0E-57
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 2 591 2.0E-57
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 15 591 3.0E-57
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1 591 3.0E-57
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 6 591 5.0E-57
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 6 591 1.0E-56
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 6 591 2.0E-56
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 6 591 3.0E-55
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 10 590 1.0E-54
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 6 591 2.0E-53
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 14 591 9.0E-52
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 10 578 1.0E-51
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 10 578 2.0E-50
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 3 294 1.0E-45
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3 288 3.0E-42
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 12 331 3.0E-38
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 3 346 4.0E-38
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 11 306 6.0E-38
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 7 288 2.0E-37
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 5 212 3.0E-37
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3 292 6.0E-37
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 9 290 1.0E-36
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 2 205 3.0E-36
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 289 2.0E-35
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 10 289 2.0E-34
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 4 292 2.0E-33
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 6 212 9.0E-32
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 5 292 1.0E-31
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 17 212 9.0E-28
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 9 292 4.0E-27
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1 295 1.0E-25
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 2 156 7.0E-25
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 7 213 2.0E-21
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 239 590 6.0E-21
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 308 590 7.0E-21
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 7 216 3.0E-20
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 308 590 3.0E-19
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 308 590 6.0E-19
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 306 591 8.0E-18
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 308 590 3.0E-14
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 310 553 1.0E-13
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 18 212 3.0E-13
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 18 212 3.0E-13
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 15 210 1.0E-12
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 15 210 1.0E-12
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 15 210 1.0E-12
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 15 210 4.0E-12
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 16 212 4.0E-12
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 308 540 9.0E-12
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 16 212 1.0E-11
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 16 184 1.0E-11
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 16 179 1.0E-11
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 18 175 2.0E-11
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 18 210 4.0E-11
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 18 212 6.0E-11
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 18 175 7.0E-11
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 16 207 7.0E-11
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 16 207 7.0E-11
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 18 220 8.0E-11
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 16 217 8.0E-11
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 16 212 9.0E-11
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 14 216 1.0E-10
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 18 212 4.0E-10
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 307 590 4.0E-10
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 308 523 5.0E-10
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 63 207 5.0E-10
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 16 179 8.0E-10
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 88 212 9.0E-10
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 88 212 9.0E-10
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 88 212 9.0E-10
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 88 212 9.0E-10
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 68 175 1.0E-09
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 18 212 1.0E-09
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 14 175 1.0E-09
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 16 212 2.0E-09
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 18 214 3.0E-09
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 16 212 4.0E-09
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 72 207 5.0E-09
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 16 175 7.0E-09
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 18 212 8.0E-09
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 18 207 1.0E-08
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 16 175 1.0E-08
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 16 175 1.0E-08
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 16 175 1.0E-08
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 16 175 1.0E-08
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 16 175 1.0E-08
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 16 175 1.0E-08
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 308 514 2.0E-08
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 16 208 7.0E-08
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 16 208 7.0E-08
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 16 208 7.0E-08
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 16 208 7.0E-08
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 18 179 1.0E-07
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 310 590 1.0E-07
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 16 212 1.0E-07
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 16 212 4.0E-07
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 18 212 5.0E-07
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 16 212 9.0E-07
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 307 520 1.0E-06
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 18 207 1.0E-06
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 16 212 2.0E-06
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 16 212 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3063
Ophiocordyceps australis map64 (Brazil) OphauB2|5406
Ophiocordyceps australis map64 (Brazil) OphauB2|3017
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5635
MTLDMTKQGILSFDGSCKTFDAAVDGYARSEAVNAIFIKRLDDAIRDRDPIRAVIRATASNSNGKTQSLMKPSSS
GQEQVIRKAYEIAGIGDLSRTAYVECHGTGTVTGDDKEGNAVARVFGQHGVYIGSVKSNVGHTEGASGITGVIKA
VLALEHRAIPPDLHFSQPNPAIPFDQAGLRVPVEETPWPPGRLPRVSVSSFGIGGSNTHVIIDSTDSFFRAGCNG
LSKNCKKVARLMPVSAKSAKSLQGRIEAIKDYLKRQASPPIDQAAYTLGVRRDHLCHRAFCIANDNEVFDFETGP
QVQAAPRVLFAFTGQGANWDAIAAQLMRQSPSFRQDIQDMDETLQSLDNAPSWTIEDILLGRQDADMLGQAEVDQ
PVSVAVQLAIVNFLGLLGVRPDAVVGHSSGEMAAAYAAGSLTQSETIICAYIRGKNVKTSDKGGAMAAVGLGRDG
VASLLSKGVTIACENSDSSVTISGDKEAIHQTVAAIRAQDATVTTKILPIDVAYHTSHMCEQGQDIEARLQPLLS
AKAPGISFFSTVTGRQLDSGTLLGPSYWRSNLESPVLFNTAMQALVHHFQDEAAVIVEIGPHSALQVLKCRS*
Coding >OphauB2|5635
ATGACTCTAGACATGACGAAGCAAGGCATCTTATCTTTTGATGGCTCCTGCAAGACTTTTGATGCAGCAGTCGAT
GGATATGCCCGAAGTGAAGCGGTCAACGCCATCTTTATTAAGCGCCTAGACGATGCTATTCGCGACAGGGATCCT
ATTCGGGCCGTAATTCGGGCGACGGCTTCTAATTCCAACGGCAAGACACAAAGTTTAATGAAGCCAAGTAGCAGT
GGCCAAGAGCAAGTCATTCGAAAGGCATATGAAATTGCCGGTATTGGTGACCTTTCCCGGACGGCATATGTTGAG
TGTCACGGCACCGGCACGGTGACGGGTGATGACAAGGAAGGAAACGCCGTGGCACGCGTTTTTGGCCAACACGGC
GTCTATATTGGCTCGGTCAAGTCCAACGTTGGCCACACTGAAGGGGCCTCGGGAATCACGGGCGTGATAAAGGCC
GTCTTAGCCCTAGAACATAGGGCGATACCGCCCGATCTCCACTTCTCCCAACCTAATCCAGCGATTCCCTTTGAC
CAAGCAGGACTGAGGGTGCCAGTGGAAGAGACCCCATGGCCCCCGGGCAGGCTGCCTAGAGTTAGCGTCAGCTCA
TTTGGTATAGGCGGGTCCAACACTCATGTCATTATCGACTCTACCGACTCGTTTTTCAGAGCTGGCTGCAATGGA
CTCTCCAAAAACTGCAAAAAGGTTGCTCGTCTGATGCCCGTCTCGGCAAAAAGTGCAAAGTCGCTGCAAGGCCGC
ATAGAGGCCATCAAAGACTACTTGAAGCGCCAGGCCTCGCCTCCGATTGACCAAGCCGCATATACTCTGGGCGTG
CGCCGCGACCATCTCTGTCACCGGGCATTCTGCATCGCCAACGACAATGAAGTATTCGACTTTGAAACAGGACCC
CAGGTCCAAGCCGCGCCTCGCGTCTTGTTTGCCTTTACTGGCCAGGGCGCTAATTGGGACGCAATTGCCGCACAG
CTGATGCGGCAGTCACCCTCTTTTCGCCAGGACATCCAAGACATGGATGAGACGCTCCAGAGCTTGGACAATGCG
CCGTCGTGGACAATCGAGGACATTCTACTGGGCCGCCAAGACGCCGACATGCTTGGTCAAGCCGAGGTTGACCAG
CCCGTCTCCGTAGCGGTGCAGCTTGCTATCGTCAATTTTCTTGGCCTTTTGGGTGTTAGACCCGATGCCGTTGTC
GGCCACTCAAGTGGTGAAATGGCTGCTGCCTACGCGGCCGGCAGCCTGACTCAAAGCGAGACCATTATATGCGCT
TATATTCGTGGAAAGAATGTCAAAACCAGTGATAAAGGGGGCGCAATGGCAGCTGTGGGTCTTGGGCGAGATGGC
GTTGCCTCCCTTCTCTCCAAAGGCGTCACCATTGCCTGTGAGAACAGTGACAGCAGCGTCACCATTTCGGGAGAC
AAGGAGGCCATCCACCAGACTGTTGCGGCAATTCGGGCCCAAGACGCCACCGTTACCACCAAGATACTGCCGATT
GATGTAGCATATCACACGAGCCATATGTGCGAGCAAGGCCAAGACATTGAGGCCAGGTTGCAGCCCCTACTATCG
GCCAAGGCGCCTGGAATCTCTTTTTTTTCTACCGTGACGGGTCGACAGCTGGACTCTGGGACCCTTCTCGGTCCG
TCTTACTGGCGGAGCAACCTCGAGTCGCCAGTTCTCTTCAACACAGCCATGCAGGCTCTTGTCCATCATTTCCAA
GACGAAGCGGCCGTCATTGTGGAAATTGGTCCTCATTCTGCTCTGCAGGTCCTCAAATGCCGCTCCTGA
Transcript >OphauB2|5635
ATGACTCTAGACATGACGAAGCAAGGCATCTTATCTTTTGATGGCTCCTGCAAGACTTTTGATGCAGCAGTCGAT
GGATATGCCCGAAGTGAAGCGGTCAACGCCATCTTTATTAAGCGCCTAGACGATGCTATTCGCGACAGGGATCCT
ATTCGGGCCGTAATTCGGGCGACGGCTTCTAATTCCAACGGCAAGACACAAAGTTTAATGAAGCCAAGTAGCAGT
GGCCAAGAGCAAGTCATTCGAAAGGCATATGAAATTGCCGGTATTGGTGACCTTTCCCGGACGGCATATGTTGAG
TGTCACGGCACCGGCACGGTGACGGGTGATGACAAGGAAGGAAACGCCGTGGCACGCGTTTTTGGCCAACACGGC
GTCTATATTGGCTCGGTCAAGTCCAACGTTGGCCACACTGAAGGGGCCTCGGGAATCACGGGCGTGATAAAGGCC
GTCTTAGCCCTAGAACATAGGGCGATACCGCCCGATCTCCACTTCTCCCAACCTAATCCAGCGATTCCCTTTGAC
CAAGCAGGACTGAGGGTGCCAGTGGAAGAGACCCCATGGCCCCCGGGCAGGCTGCCTAGAGTTAGCGTCAGCTCA
TTTGGTATAGGCGGGTCCAACACTCATGTCATTATCGACTCTACCGACTCGTTTTTCAGAGCTGGCTGCAATGGA
CTCTCCAAAAACTGCAAAAAGGTTGCTCGTCTGATGCCCGTCTCGGCAAAAAGTGCAAAGTCGCTGCAAGGCCGC
ATAGAGGCCATCAAAGACTACTTGAAGCGCCAGGCCTCGCCTCCGATTGACCAAGCCGCATATACTCTGGGCGTG
CGCCGCGACCATCTCTGTCACCGGGCATTCTGCATCGCCAACGACAATGAAGTATTCGACTTTGAAACAGGACCC
CAGGTCCAAGCCGCGCCTCGCGTCTTGTTTGCCTTTACTGGCCAGGGCGCTAATTGGGACGCAATTGCCGCACAG
CTGATGCGGCAGTCACCCTCTTTTCGCCAGGACATCCAAGACATGGATGAGACGCTCCAGAGCTTGGACAATGCG
CCGTCGTGGACAATCGAGGACATTCTACTGGGCCGCCAAGACGCCGACATGCTTGGTCAAGCCGAGGTTGACCAG
CCCGTCTCCGTAGCGGTGCAGCTTGCTATCGTCAATTTTCTTGGCCTTTTGGGTGTTAGACCCGATGCCGTTGTC
GGCCACTCAAGTGGTGAAATGGCTGCTGCCTACGCGGCCGGCAGCCTGACTCAAAGCGAGACCATTATATGCGCT
TATATTCGTGGAAAGAATGTCAAAACCAGTGATAAAGGGGGCGCAATGGCAGCTGTGGGTCTTGGGCGAGATGGC
GTTGCCTCCCTTCTCTCCAAAGGCGTCACCATTGCCTGTGAGAACAGTGACAGCAGCGTCACCATTTCGGGAGAC
AAGGAGGCCATCCACCAGACTGTTGCGGCAATTCGGGCCCAAGACGCCACCGTTACCACCAAGATACTGCCGATT
GATGTAGCATATCACACGAGCCATATGTGCGAGCAAGGCCAAGACATTGAGGCCAGGTTGCAGCCCCTACTATCG
GCCAAGGCGCCTGGAATCTCTTTTTTTTCTACCGTGACGGGTCGACAGCTGGACTCTGGGACCCTTCTCGGTCCG
TCTTACTGGCGGAGCAACCTCGAGTCGCCAGTTCTCTTCAACACAGCCATGCAGGCTCTTGTCCATCATTTCCAA
GACGAAGCGGCCGTCATTGTGGAAATTGGTCCTCATTCTGCTCTGCAGGTCCTCAAATGCCGCTCCTGA
Gene >OphauB2|5635
ATGACTCTAGACATGACGAAGCAAGGCATCTTATCTTTTGATGGCTCCTGCAAGACTTTTGATGCAGCAGTCGAT
GGATATGCCCGAAGTGAAGCGGTCAACGCCATCTTTATTAAGCGCCTAGACGATGCTATTCGCGACAGGGATCCT
ATTCGGGCCGTAATTCGGGCGACGGCTTCTAATTCCAACGGCAAGACACAAAGTTTAATGAAGCCAAGTAGCAGT
GGCCAAGAGCAAGTCATTCGAAAGGCATATGAAATTGCCGGTATTGGTGACCTTTCCCGGACGGCATATGTTGAG
TGTCACGGCACCGGCACGGTGACGGGTGATGACAAGGAAGGAAACGCCGTGGCACGCGTTTTTGGCCAACACGGC
GTCTATATTGGCTCGGTGAGTTGCAAGCACGGCTGGTAATAAGTGTGACTGCGCTAACCGCCATATAGGTCAAGT
CCAACGTTGGCCACACTGAAGGGGCCTCGGGAATCACGGGCGTGATAAAGGCCGTCTTAGCCCTAGAACATAGGG
CGATACCGCCCGATCTCCACTTCTCCCAACCTAATCCAGCGAGTAAGCAACTAGCGTCTAGTTACAGCTCCTTGA
ACTTGGCTCACCAGATTTTGCATCCAGTTCCCTTTGACCAAGCAGGACTGAGGGTGCCAGTGGAAGAGACCCCAT
GGCCCCCGGGCAGGCTGCCTAGAGTTAGCGTCAGCTCATTTGGTATAGGCGGGTCCAACACTCATGTAAGCCGTC
TAAGCGCCAAAGCCTAGACCTGGACCTGTCAAGCTCACCCAGCCTCTGTTAGGTCATTATCGACTCTACCGACTC
GTTTTTCAGAGCTGGCTGCAATGGACTCTCCAAAAACTGCAAAAAGGTTGCTCGTCTGATGCCCGTCTCGGCAAA
AAGTGCAAAGTCGCTGCAAGGCCGCATAGAGGCCATCAAAGACTACTTGAAGCGCCAGGCCTCGCCTCCGATTGA
CCAAGCCGCATATACTCTGGGCGTGCGCCGCGACCATCTCTGTCACCGGGCATTCTGCATCGCCAACGACAATGA
AGTATTCGACTTTGAAACAGGACCCCAGGTCCAAGCCGCGCCTCGCGTCTTGTTTGCCTTTACTGGCCAGGGCGC
TAATTGGGACGCAATTGCCGCACAGCTGATGCGGCAGTCACCCTCTTTTCGCCAGGACATCCAAGACATGGATGA
GACGCTCCAGAGCTTGGACAATGCGCCGTCGTGGACAATCGAGGGTAGGTTGGGGCCTTGGCTATGCCGCGGCTT
GTATTCTACTAACTCTGGAGTCTGATAGACATTCTACTGGGCCGCCAAGACGCCGACATGCTTGGTCAAGCCGAG
GTTGACCAGCCCGTCTCCGTAGCGGTGCAGCTTGCTATCGTCAATTTTCTTGGCCTTTTGGGTGTTAGACCCGAT
GCCGTTGTCGGCCACTCAAGTGGTGAAATGGCTGCTGCCTACGCGGCCGGCAGCCTGACTCAAAGCGAGACCATT
ATATGCGCTTATATTCGTGGAAAGAATGTCAAAACCAGTGATAAAGGGGGCGCAATGGCAGCTGTGGGTCTTGGG
CGAGATGGCGTTGCCTCCCTTCTCTCCAAAGGCGTCACCATTGCCTGTGAGAACAGTGACAGCAGCGTCACCATT
TCGGGAGACAAGGAGGCCATCCACCAGACTGTTGCGGCAATTCGGGCCCAAGACGCCACCGTTACCACCAAGATA
CTGCCGATTGATGTAGCATATCACACGAGTAAGAGGGTCCAGGCACCATGAGCAGTAGCAATTCAAGCTGATCAG
TATAAAATCTAGGCCATATGTGCGAGCAAGGCCAAGACATTGAGGCCAGGTTGCAGCCCCTACTATCGGCCAAGG
CGCCTGGAATCTCTTTTTTTTCTACCGTGACGGGTCGACAGCTGGACTCTGGGACCCTTCTCGGTCCGTCTTACT
GGCGGAGCAACCTCGAGTCGCCAGTTCTCTTCAACACAGCCATGCAGGCTCTTGTCCATCATTTCCAAGACGAAG
CGGCCGTCATTGTGGAAATTGGTCCTCATTCTGCTCTGCAGGGTTATATTAAGCAGATTCTTCGCCATGTCCCTT
GCAAAACATTGCCTCATTACATTCCTACCTTAATTCGAAACAAGAATTGCTTCGTCTCCATGCTCCAAGCCATTG
GCCGGCTTTATACGCACGGGTGTGCCGTTGATTTTTCTTTTCTTAGTCCTCAAATGCCGCTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail