Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5632
Gene name
LocationContig_45:72278..73652
Strand+
Gene length (bp)1374
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12588 PSDC Phophatidylserine decarboxylase 4.4E-49 53 190
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 1.1E-28 225 427

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 202 428 5.0E-18
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 221 427 9.0E-16
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 208 432 1.0E-14
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 217 427 1.0E-14
sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 183 427 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 202 428 5.0E-18
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 221 427 9.0E-16
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 208 432 1.0E-14
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 217 427 1.0E-14
sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 183 427 1.0E-12
sp|A8MJ83|PSD_ALKOO Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 213 426 3.0E-12
sp|A9VHW5|PSD_BACWK Phosphatidylserine decarboxylase proenzyme OS=Bacillus weihenstephanensis (strain KBAB4) GN=psd PE=3 SV=1 208 448 3.0E-12
sp|A0Q3R9|PSD_CLONN Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 205 427 4.0E-12
sp|Q818C6|PSD_BACCR Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=psd PE=3 SV=1 206 428 7.0E-12
sp|B7HCW5|PSD_BACC4 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain B4264) GN=psd PE=3 SV=1 206 428 7.0E-12
sp|B7IYJ1|PSD_BACC2 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain G9842) GN=psd PE=3 SV=1 206 428 7.0E-12
sp|Q730J7|PSD_BACC1 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=psd PE=3 SV=2 206 428 1.0E-11
sp|C3P929|PSD_BACAA Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain A0248) GN=psd PE=3 SV=1 206 428 1.0E-11
sp|C3L5U2|PSD_BACAC Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=psd PE=3 SV=1 206 428 1.0E-11
sp|Q81LP7|PSD_BACAN Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis GN=psd PE=3 SV=1 206 428 1.0E-11
sp|B7JNX0|PSD_BACC0 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH820) GN=psd PE=3 SV=1 206 428 1.0E-11
sp|B7HPN7|PSD_BACC7 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH187) GN=psd PE=3 SV=1 206 428 1.0E-11
sp|Q634K5|PSD_BACCZ Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ZK / E33L) GN=psd PE=3 SV=1 206 428 1.0E-11
sp|Q5JN42|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 191 427 2.0E-11
sp|C1ESN2|PSD_BACC3 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain 03BB102) GN=psd PE=3 SV=1 206 428 4.0E-11
sp|B7GKA2|PSD_ANOFW Phosphatidylserine decarboxylase proenzyme OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=psd PE=3 SV=1 273 428 4.0E-11
sp|A0RIV4|PSD_BACAH Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis (strain Al Hakam) GN=psd PE=3 SV=1 206 428 4.0E-11
sp|Q6HDI5|PSD_BACHK Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=psd PE=3 SV=1 208 428 5.0E-11
sp|Q0TV39|PSD_CLOP1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=psd PE=3 SV=1 212 428 1.0E-10
sp|Q9HUK8|PSD_PSEAE Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=psd PE=3 SV=1 220 425 3.0E-10
sp|Q0SWT6|PSD_CLOPS Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain SM101 / Type A) GN=psd PE=3 SV=1 221 428 3.0E-10
sp|A7GT32|PSD_BACCN Phosphatidylserine decarboxylase proenzyme OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=psd PE=3 SV=1 206 426 4.0E-10
sp|A6VD70|PSD_PSEA7 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain PA7) GN=psd PE=3 SV=1 220 436 5.0E-10
sp|Q8XPD5|PSD_CLOPE Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain 13 / Type A) GN=psd PE=3 SV=1 212 428 6.0E-10
sp|C5D4W6|PSD_GEOSW Phosphatidylserine decarboxylase proenzyme OS=Geobacillus sp. (strain WCH70) GN=psd PE=3 SV=1 206 427 6.0E-10
sp|B7V346|PSD_PSEA8 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain LESB58) GN=psd PE=3 SV=1 220 425 7.0E-10
sp|Q02F61|PSD_PSEAB Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=psd PE=3 SV=1 220 425 7.0E-10
sp|C4K3T9|PSD_HAMD5 Phosphatidylserine decarboxylase proenzyme OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=psd PE=3 SV=1 206 431 1.0E-09
sp|Q3KJ03|PSD_PSEPF Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf0-1) GN=psd PE=3 SV=1 220 433 1.0E-09
sp|B2I1N9|PSD_ACIBC Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ACICU) GN=psd PE=3 SV=1 221 432 1.0E-09
sp|B7GUX2|PSD_ACIB3 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB307-0294) GN=psd PE=3 SV=1 221 432 1.0E-09
sp|B0V9W1|PSD_ACIBY Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AYE) GN=psd PE=3 SV=1 221 432 1.0E-09
sp|A3MA23|PSD_ACIBT Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=psd PE=3 SV=2 221 432 1.0E-09
sp|B7I242|PSD_ACIB5 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB0057) GN=psd PE=3 SV=1 221 432 1.0E-09
sp|Q2YB83|PSD_NITMU Phosphatidylserine decarboxylase proenzyme OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=psd PE=3 SV=1 229 427 2.0E-09
sp|B0VP52|PSD_ACIBS Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain SDF) GN=psd PE=3 SV=1 221 432 4.0E-09
sp|Q4KJ87|PSD_PSEF5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=psd PE=3 SV=1 221 427 4.0E-09
sp|Q899T7|PSD_CLOTE Phosphatidylserine decarboxylase proenzyme OS=Clostridium tetani (strain Massachusetts / E88) GN=psd PE=3 SV=1 221 427 4.0E-09
sp|C3KDM6|PSD_PSEFS Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain SBW25) GN=psd PE=3 SV=1 220 440 6.0E-09
sp|Q5ZRA9|PSD_LEGPH Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=psd PE=3 SV=1 221 440 6.0E-09
sp|A5IIH5|PSD_LEGPC Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Corby) GN=psd PE=3 SV=1 221 440 8.0E-09
sp|Q6F6W3|PSD_ACIAD Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 221 432 8.0E-09
sp|Q21H90|PSD_SACD2 Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 196 426 1.0E-08
sp|A1SZV9|PSD_PSYIN Phosphatidylserine decarboxylase proenzyme OS=Psychromonas ingrahamii (strain 37) GN=psd PE=3 SV=1 208 427 1.0E-08
sp|C1DLP2|PSD_AZOVD Phosphatidylserine decarboxylase proenzyme OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=psd PE=3 SV=1 221 438 2.0E-08
sp|A5W9U4|PSD_PSEP1 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=psd PE=3 SV=1 221 436 2.0E-08
sp|A7G9C7|PSD_CLOBL Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=psd PE=3 SV=1 220 427 2.0E-08
sp|Q5WSH5|PSD_LEGPL Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Lens) GN=psd PE=3 SV=1 221 440 2.0E-08
sp|Q1I433|PSD_PSEE4 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas entomophila (strain L48) GN=psd PE=3 SV=1 221 436 2.0E-08
sp|Q5X0Q0|PSD_LEGPA Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Paris) GN=psd PE=3 SV=1 221 440 2.0E-08
sp|Q88DB9|PSD_PSEPK Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain KT2440) GN=psd PE=3 SV=1 221 436 3.0E-08
sp|B1JAE9|PSD_PSEPW Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain W619) GN=psd PE=3 SV=1 220 436 3.0E-08
sp|Q07XV9|PSD_SHEFN Phosphatidylserine decarboxylase proenzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=psd PE=3 SV=1 208 439 4.0E-08
sp|B0KL10|PSD_PSEPG Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain GB-1) GN=psd PE=3 SV=1 221 436 4.0E-08
sp|C1FPI8|PSD_CLOBJ Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Kyoto / Type A2) GN=psd PE=3 SV=1 221 428 5.0E-08
sp|A4G529|PSD_HERAR Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 213 427 5.0E-08
sp|Q9Z767|PSD_CHLPN Phosphatidylserine decarboxylase proenzyme OS=Chlamydia pneumoniae GN=psd PE=3 SV=1 201 424 9.0E-08
sp|A7FQ59|PSD_CLOB1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=psd PE=3 SV=1 220 427 9.0E-08
sp|A5HXS0|PSD_CLOBH Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=psd PE=3 SV=1 220 427 9.0E-08
sp|C3KXS2|PSD_CLOB6 Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain 657 / Type Ba4) GN=psd PE=3 SV=1 221 428 1.0E-07
sp|Q0VMD7|PSD_ALCBS Phosphatidylserine decarboxylase proenzyme OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=psd PE=3 SV=1 265 424 1.0E-07
sp|A9IM91|PSD_BORPD Phosphatidylserine decarboxylase proenzyme OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=psd PE=3 SV=1 220 425 2.0E-07
sp|A4XPX3|PSD_PSEMY Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas mendocina (strain ymp) GN=psd PE=3 SV=1 221 425 3.0E-07
sp|Q4FQD5|PSD_PSYA2 Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 190 432 8.0E-07
sp|Q1Q8K8|PSD_PSYCK Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 190 441 4.0E-06
sp|Q47C25|PSD_DECAR Phosphatidylserine decarboxylase proenzyme OS=Dechloromonas aromatica (strain RCB) GN=psd PE=3 SV=1 212 428 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008654 phospholipid biosynthetic process Yes
GO:0004609 phosphatidylserine decarboxylase activity Yes
GO:0019637 organophosphate metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0016829 lyase activity No
GO:1901576 organic substance biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0016830 carbon-carbon lyase activity No
GO:0044249 cellular biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0016831 carboxy-lyase activity No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup309
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2710
Ophiocordyceps australis map64 (Brazil) OphauB2|5632 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5656
Ophiocordyceps camponoti-floridani Ophcf2|00043
Ophiocordyceps camponoti-rufipedis Ophun1|6281
Ophiocordyceps kimflemingae Ophio5|2558
Ophiocordyceps subramaniannii Hirsu2|1125
Ophiocordyceps subramaniannii Hirsu2|3028
Ophiocordyceps subramaniannii Hirsu2|3864
Ophiocordyceps subramaniannii Hirsu2|989

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5632
MSKVVPIMPVRPHHRFHRVGGWLPENPNVVIRWLKDLVKDVDRRKRTPNLVGPVQELKALIESTAELRMLASAMF
DEVPDKDPYREDPVGNKQVRSYKHMLILFQVIMSEVAPKWSMTEYGVGLIGFPFNALLDWPMATASGYAFFLKTE
VNAKLKDILDTWRSTVLTTDKSLYVLVEGEDGWLGPEPRAKIESDTNVTDHPELKFHELFECNPDEPHWGFKHWD
DFFIRKFRNFDKIRPTAFKDRPEWIVNSCESKPFALQLNVQANDTFWLKGQPYSVREMLNGHEWADKFVGGTVYQ
AFLSATSYHRWNSPVTGKVVHSQIIDGTYFSEPTITGFTSPEGPDPAAPDQAQGYITHIATRALVFIEAAAPVGL
VAIVYVGMSDVSSCEILQKFESSKLPVNVTKGEELGMFHHGGSTHAMLFGKDVKLAWVTGAMPGALSHNLAVRSE
LAMVYKK*
Coding >OphauB2|5632
ATGTCCAAAGTTGTTCCCATTATGCCGGTTCGGCCTCACCACCGCTTCCATCGTGTGGGCGGCTGGCTGCCCGAG
AACCCCAATGTTGTTATCCGCTGGCTCAAGGACCTGGTCAAGGACGTGGACCGTCGGAAGAGGACGCCCAATCTA
GTTGGCCCTGTGCAGGAGCTCAAGGCGCTGATTGAAAGCACCGCGGAGCTGCGCATGCTAGCCTCGGCCATGTTT
GACGAGGTGCCGGACAAGGACCCCTACCGCGAGGATCCCGTGGGCAACAAGCAAGTGCGCAGCTACAAGCACATG
CTGATTCTCTTTCAAGTCATTATGAGCGAGGTGGCGCCCAAATGGAGCATGACGGAGTATGGGGTGGGCTTGATT
GGCTTCCCCTTTAATGCGCTGCTGGACTGGCCCATGGCCACGGCGAGTGGATATGCATTTTTCCTCAAGACAGAG
GTGAATGCGAAGCTCAAGGACATTCTCGATACGTGGCGCAGCACAGTCTTGACGACGGACAAGTCGCTCTATGTG
CTGGTTGAGGGCGAGGACGGCTGGCTGGGCCCGGAGCCTCGCGCCAAGATTGAAAGCGACACCAACGTGACGGAC
CATCCAGAGCTCAAGTTTCATGAGTTGTTTGAATGCAATCCCGATGAGCCGCACTGGGGCTTTAAGCACTGGGAC
GATTTCTTCATCCGCAAGTTTCGCAACTTTGACAAGATTCGTCCCACGGCATTCAAAGACCGTCCCGAGTGGATT
GTCAACTCGTGCGAGTCGAAGCCCTTTGCACTGCAGCTCAATGTCCAGGCAAACGACACCTTTTGGCTCAAGGGG
CAGCCGTACTCGGTCCGCGAGATGCTCAACGGCCATGAGTGGGCAGACAAGTTTGTCGGCGGCACCGTCTACCAG
GCCTTTTTGAGCGCCACCTCGTACCATCGCTGGAACTCGCCCGTGACGGGCAAGGTGGTGCATAGCCAGATAATT
GACGGTACTTACTTTTCCGAGCCCACCATTACGGGCTTTACGTCGCCCGAGGGGCCTGACCCTGCGGCGCCGGAC
CAGGCCCAGGGCTACATTACGCACATTGCCACGCGGGCTCTTGTTTTTATCGAGGCGGCGGCGCCGGTTGGCCTC
GTGGCGATTGTATATGTCGGCATGTCGGATGTTTCTTCGTGTGAGATTTTGCAAAAGTTTGAGTCGTCAAAGTTG
CCCGTCAATGTCACAAAGGGAGAGGAGCTAGGCATGTTTCATCATGGGGGCTCGACGCATGCTATGCTCTTTGGA
AAGGACGTTAAGCTTGCCTGGGTTACGGGCGCTATGCCGGGGGCTTTGAGTCACAATTTGGCTGTTCGTAGTGAG
TTGGCCATGGTTTACAAAAAGTGA
Transcript >OphauB2|5632
ATGTCCAAAGTTGTTCCCATTATGCCGGTTCGGCCTCACCACCGCTTCCATCGTGTGGGCGGCTGGCTGCCCGAG
AACCCCAATGTTGTTATCCGCTGGCTCAAGGACCTGGTCAAGGACGTGGACCGTCGGAAGAGGACGCCCAATCTA
GTTGGCCCTGTGCAGGAGCTCAAGGCGCTGATTGAAAGCACCGCGGAGCTGCGCATGCTAGCCTCGGCCATGTTT
GACGAGGTGCCGGACAAGGACCCCTACCGCGAGGATCCCGTGGGCAACAAGCAAGTGCGCAGCTACAAGCACATG
CTGATTCTCTTTCAAGTCATTATGAGCGAGGTGGCGCCCAAATGGAGCATGACGGAGTATGGGGTGGGCTTGATT
GGCTTCCCCTTTAATGCGCTGCTGGACTGGCCCATGGCCACGGCGAGTGGATATGCATTTTTCCTCAAGACAGAG
GTGAATGCGAAGCTCAAGGACATTCTCGATACGTGGCGCAGCACAGTCTTGACGACGGACAAGTCGCTCTATGTG
CTGGTTGAGGGCGAGGACGGCTGGCTGGGCCCGGAGCCTCGCGCCAAGATTGAAAGCGACACCAACGTGACGGAC
CATCCAGAGCTCAAGTTTCATGAGTTGTTTGAATGCAATCCCGATGAGCCGCACTGGGGCTTTAAGCACTGGGAC
GATTTCTTCATCCGCAAGTTTCGCAACTTTGACAAGATTCGTCCCACGGCATTCAAAGACCGTCCCGAGTGGATT
GTCAACTCGTGCGAGTCGAAGCCCTTTGCACTGCAGCTCAATGTCCAGGCAAACGACACCTTTTGGCTCAAGGGG
CAGCCGTACTCGGTCCGCGAGATGCTCAACGGCCATGAGTGGGCAGACAAGTTTGTCGGCGGCACCGTCTACCAG
GCCTTTTTGAGCGCCACCTCGTACCATCGCTGGAACTCGCCCGTGACGGGCAAGGTGGTGCATAGCCAGATAATT
GACGGTACTTACTTTTCCGAGCCCACCATTACGGGCTTTACGTCGCCCGAGGGGCCTGACCCTGCGGCGCCGGAC
CAGGCCCAGGGCTACATTACGCACATTGCCACGCGGGCTCTTGTTTTTATCGAGGCGGCGGCGCCGGTTGGCCTC
GTGGCGATTGTATATGTCGGCATGTCGGATGTTTCTTCGTGTGAGATTTTGCAAAAGTTTGAGTCGTCAAAGTTG
CCCGTCAATGTCACAAAGGGAGAGGAGCTAGGCATGTTTCATCATGGGGGCTCGACGCATGCTATGCTCTTTGGA
AAGGACGTTAAGCTTGCCTGGGTTACGGGCGCTATGCCGGGGGCTTTGAGTCACAATTTGGCTGTTCGTAGTGAG
TTGGCCATGGTTTACAAAAAGTGA
Gene >OphauB2|5632
ATGTCCAAAGTTGTTCCCATTATGCCGGTTCGGCCTCACCACCGCTTCCATCGTGTGGGCGGCTGGCTGCCCGAG
AACCCCAATGTTGTTATCCGCTGGCTCAAGGACCTGGTCAAGGACGTGGACCGTCGGAAGAGGACGCCCAATCTA
GTTGGCCCTGTGCAGGAGCTCAAGGCGCTGATTGAAAGCACCGCGGAGCTGCGCATGCTAGCCTCGGCCATGTTT
GACGAGGTGCCGGACAAGGACCCCTACCGCGAGGATCCCGTGGGCAACAAGCAAGTGCGCAGCTACAAGCACATG
CTGATTCTCTTTCAAGTCATTATGAGCGAGGTGGCGCCCAAATGGAGCATGACGGAGTATGGGGTGGGCTTGATT
GGCTTCCCCTTTAATGCGCTGCTGGACTGGCCCATGGCCACGGCGAGTGGATATGCATTTTTCCTCAAGACAGAG
GTGAATGCGAAGCTCAAGGACATTCTCGATACGTGGCGCAGCACAGTCTTGACGACGGACAAGTCGCTCTATGTG
CTGGTTGAGGGCGAGGACGGCTGGCTGGGCCCGGAGCCTCGCGCCAAGATTGAAAGCGACACCAACGTGACGGAC
CATCCAGAGCTCAAGTTTCATGAGTTGTTTGAATGCAATCCCGATGAGCCGCACTGGGGCTTTAAGCACTGGGAC
GATTTCTTCATCCGCAAGTTTCGCAACTTTGACAAGATTCGTCCCACGGCATTCAAAGACCGTCCCGAGTGGATT
GTCAACTCGTGCGAGTCGAAGCCCTTTGCACTGCAGCTCAATGTCCAGGCAAACGACACCTTTTGGCTCAAGGGG
CAGCCGTACTCGGTCCGCGAGATGCTCAACGGCCATGAGTGGGCAGACAAGTTTGTCGGCGGCACCGTCTACCAG
GCCTTTTTGAGCGCCACCTCGTACCATCGCTGGAACTCGCCCGTGACGGGCAAGGTGGTGCATAGCCAGATAATT
GACGGTACTTACTTTTCCGAGCCCACCATTACGGGCTTTACGTCGCCCGAGGGGCCTGACCCTGCGGCGCCGGAC
CAGGCCCAGGGCTACATTACGCACATTGCCACGCGGGCTCTTGTTTTTATCGAGGCGGCGGCGCCGGTTGGCCTC
GTGGCGATTGTATATGTCGGCATGTCGGATGTTTCTTCGTGTGAGATTTTGCAAAAGTTTGAGTCGTCAAAGTTG
CCCGTCAATGTCACAAAGGGAGAGGAGCTAGGCATGTTTCATCATGGGGGCTCGACGCATGCTATGCTCTTTGGA
AAGGACGTTAAGCTTGCCTGGGTTACGGGCGCTATGCCGGGGGCTTTGAGTCACAATTTGGCTGTTCGTAGTGAG
TTGGCCATGGTTTACAAAAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail