Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5630
Gene name
LocationContig_45:67539..68304
Strand-
Gene length (bp)765
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00957 Synaptobrevin Synaptobrevin 1.1E-30 147 232
PF13774 Longin Regulated-SNARE-like domain 2.3E-28 38 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86AQ7|VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum GN=vamp7B PE=3 SV=1 10 218 3.0E-29
sp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=1 SV=1 11 228 1.0E-28
sp|Q9LFP1|VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1 11 225 5.0E-28
sp|Q9SIQ9|VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana GN=VAMP712 PE=2 SV=1 11 212 2.0E-27
sp|O49377|VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=1 SV=2 11 212 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86AQ7|VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum GN=vamp7B PE=3 SV=1 10 218 3.0E-29
sp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=1 SV=1 11 228 1.0E-28
sp|Q9LFP1|VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1 11 225 5.0E-28
sp|Q9SIQ9|VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana GN=VAMP712 PE=2 SV=1 11 212 2.0E-27
sp|O49377|VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=1 SV=2 11 212 1.0E-26
sp|Q9MAS5|VA726_ARATH Putative vesicle-associated membrane protein 726 OS=Arabidopsis thaliana GN=VAMP726 PE=2 SV=2 11 217 3.0E-26
sp|P47192|VA722_ARATH Vesicle-associated membrane protein 722 OS=Arabidopsis thaliana GN=VAMP722 PE=2 SV=2 7 213 1.0E-25
sp|Q54NW7|VAM7A_DICDI Vesicle-associated membrane protein 7A OS=Dictyostelium discoideum GN=vamp7A PE=1 SV=1 7 234 2.0E-25
sp|O48850|VA725_ARATH Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana GN=VAMP725 PE=2 SV=2 11 213 1.0E-24
sp|Q9ZTW3|VA721_ARATH Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana GN=VAMP721 PE=1 SV=1 7 213 3.0E-24
sp|Q9M376|VA727_ARATH Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana GN=VAMP727 PE=2 SV=1 11 226 7.0E-23
sp|Q9JHW5|VAMP7_RAT Vesicle-associated membrane protein 7 OS=Rattus norvegicus GN=Vamp7 PE=1 SV=1 11 215 2.0E-22
sp|P70280|VAMP7_MOUSE Vesicle-associated membrane protein 7 OS=Mus musculus GN=Vamp7 PE=1 SV=1 11 213 3.0E-22
sp|Q5ZL74|VAMP7_CHICK Vesicle-associated membrane protein 7 OS=Gallus gallus GN=VAMP7 PE=2 SV=1 11 213 4.0E-22
sp|Q17QI5|VAMP7_BOVIN Vesicle-associated membrane protein 7 OS=Bos taurus GN=VAMP7 PE=2 SV=1 11 213 4.0E-21
sp|P51809|VAMP7_HUMAN Vesicle-associated membrane protein 7 OS=Homo sapiens GN=VAMP7 PE=1 SV=3 11 213 4.0E-21
sp|Q5RF94|VAMP7_PONAB Vesicle-associated membrane protein 7 OS=Pongo abelii GN=VAMP7 PE=2 SV=3 11 213 1.0E-20
sp|O23429|VA724_ARATH Vesicle-associated membrane protein 724 OS=Arabidopsis thaliana GN=VAMP724 PE=2 SV=2 11 213 2.0E-18
sp|Q9Y7L0|SEC22_SCHPO Protein transport protein sec22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec22 PE=3 SV=2 38 222 9.0E-15
sp|Q3T0Y8|VAMP8_BOVIN Vesicle-associated membrane protein 8 OS=Bos taurus GN=VAMP8 PE=3 SV=1 141 218 1.0E-14
sp|Q5REQ5|VAMP8_PONAB Vesicle-associated membrane protein 8 OS=Pongo abelii GN=VAMP8 PE=3 SV=1 139 218 2.0E-14
sp|Q9BV40|VAMP8_HUMAN Vesicle-associated membrane protein 8 OS=Homo sapiens GN=VAMP8 PE=1 SV=1 139 218 2.0E-14
sp|Q12255|NYV1_YEAST Vacuolar v-SNARE NYV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NYV1 PE=1 SV=2 150 225 5.0E-14
sp|Q8VY69|VA723_ARATH Vesicle-associated membrane protein 723 OS=Arabidopsis thaliana GN=VAMP723 PE=2 SV=1 7 213 7.0E-14
sp|Q32L97|VAMP4_BOVIN Vesicle-associated membrane protein 4 OS=Bos taurus GN=VAMP4 PE=2 SV=1 144 217 1.0E-13
sp|O75379|VAMP4_HUMAN Vesicle-associated membrane protein 4 OS=Homo sapiens GN=VAMP4 PE=1 SV=2 144 217 1.0E-13
sp|O70404|VAMP8_MOUSE Vesicle-associated membrane protein 8 OS=Mus musculus GN=Vamp8 PE=1 SV=1 139 213 4.0E-13
sp|Q9WUF4|VAMP8_RAT Vesicle-associated membrane protein 8 OS=Rattus norvegicus GN=Vamp8 PE=1 SV=1 147 213 5.0E-13
sp|P18489|SYB_DROME Synaptobrevin OS=Drosophila melanogaster GN=Syb PE=2 SV=3 112 232 6.0E-13
sp|Q92356|SYB1_SCHPO Synaptobrevin homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syb1 PE=3 SV=1 141 213 8.0E-13
sp|O70480|VAMP4_MOUSE Vesicle-associated membrane protein 4 OS=Mus musculus GN=Vamp4 PE=1 SV=1 144 213 2.0E-12
sp|P33328|SNC2_YEAST Synaptobrevin homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC2 PE=1 SV=2 154 217 1.0E-11
sp|Q7ZV15|S22BA_DANRE Vesicle-trafficking protein SEC22b-A OS=Danio rerio GN=sec22ba PE=2 SV=1 36 225 3.0E-11
sp|Q5ZJW4|SC22B_CHICK Vesicle-trafficking protein SEC22b OS=Gallus gallus GN=SEC22B PE=2 SV=1 32 225 8.0E-11
sp|Q4KM74|SC22B_RAT Vesicle-trafficking protein SEC22b OS=Rattus norvegicus GN=Sec22b PE=1 SV=3 32 225 2.0E-10
sp|Q5RAI9|SC22B_PONAB Vesicle-trafficking protein SEC22b OS=Pongo abelii GN=SEC22B PE=2 SV=3 32 225 2.0E-10
sp|O08547|SC22B_MOUSE Vesicle-trafficking protein SEC22b OS=Mus musculus GN=Sec22b PE=1 SV=3 32 225 2.0E-10
sp|Q60WU2|SYB1_CAEBR Synaptobrevin-1 OS=Caenorhabditis briggsae GN=snb-1 PE=3 SV=1 156 217 2.0E-10
sp|O02495|SYB1_CAEEL Synaptobrevin-1 OS=Caenorhabditis elegans GN=snb-1 PE=1 SV=1 156 218 2.0E-10
sp|O08595|SC22B_CRIGR Vesicle-trafficking protein SEC22b OS=Cricetulus griseus GN=Sec22b PE=1 SV=3 32 225 3.0E-10
sp|Q6BSL0|YKT6_DEBHA Synaptobrevin homolog YKT6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YKT6 PE=3 SV=1 80 200 6.0E-10
sp|P63045|VAMP2_RAT Vesicle-associated membrane protein 2 OS=Rattus norvegicus GN=Vamp2 PE=1 SV=2 156 219 2.0E-09
sp|P63026|VAMP2_BOVIN Vesicle-associated membrane protein 2 OS=Bos taurus GN=VAMP2 PE=1 SV=2 156 219 2.0E-09
sp|P63027|VAMP2_HUMAN Vesicle-associated membrane protein 2 OS=Homo sapiens GN=VAMP2 PE=1 SV=3 156 219 2.0E-09
sp|P63044|VAMP2_MOUSE Vesicle-associated membrane protein 2 OS=Mus musculus GN=Vamp2 PE=1 SV=2 156 219 2.0E-09
sp|Q9N0Y0|VAMP2_MACMU Vesicle-associated membrane protein 2 OS=Macaca mulatta GN=VAMP2 PE=3 SV=3 156 219 2.0E-09
sp|Q0V7N0|VAMP1_BOVIN Vesicle-associated membrane protein 1 OS=Bos taurus GN=VAMP1 PE=3 SV=2 156 220 3.0E-09
sp|Q4R8T0|VAMP3_MACFA Vesicle-associated membrane protein 3 OS=Macaca fascicularis GN=VAMP3 PE=3 SV=1 138 216 3.0E-09
sp|Q62442|VAMP1_MOUSE Vesicle-associated membrane protein 1 OS=Mus musculus GN=Vamp1 PE=1 SV=1 156 220 4.0E-09
sp|P31109|SNC1_YEAST Synaptobrevin homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC1 PE=1 SV=1 156 213 7.0E-09
sp|P47193|VAMP2_XENLA Vesicle-associated membrane protein 2 OS=Xenopus laevis GN=vamp2 PE=3 SV=3 156 219 7.0E-09
sp|Q7SXP0|S22BB_DANRE Vesicle-trafficking protein SEC22b-B OS=Danio rerio GN=sec22bb PE=2 SV=1 32 225 9.0E-09
sp|Q15836|VAMP3_HUMAN Vesicle-associated membrane protein 3 OS=Homo sapiens GN=VAMP3 PE=1 SV=3 154 216 1.0E-08
sp|P13701|SYB_TORCA Synaptobrevin OS=Torpedo californica PE=2 SV=1 156 217 1.0E-08
sp|P23763|VAMP1_HUMAN Vesicle-associated membrane protein 1 OS=Homo sapiens GN=VAMP1 PE=1 SV=1 156 220 1.0E-08
sp|Q63666|VAMP1_RAT Vesicle-associated membrane protein 1 OS=Rattus norvegicus GN=Vamp1 PE=1 SV=2 156 220 2.0E-08
sp|P35589|SYB_APLCA Synaptobrevin OS=Aplysia californica PE=2 SV=1 156 218 2.0E-08
sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens GN=SEC22B PE=1 SV=4 32 225 2.0E-08
sp|Q7ZUN8|YKT6_DANRE Synaptobrevin homolog YKT6 OS=Danio rerio GN=ykt6 PE=2 SV=1 84 200 2.0E-08
sp|P63024|VAMP3_MOUSE Vesicle-associated membrane protein 3 OS=Mus musculus GN=Vamp3 PE=1 SV=1 154 215 2.0E-08
sp|P63025|VAMP3_RAT Vesicle-associated membrane protein 3 OS=Rattus norvegicus GN=Vamp3 PE=1 SV=1 154 215 2.0E-08
sp|Q54GB3|SYBB_DICDI Synaptobrevin-B OS=Dictyostelium discoideum GN=sybB PE=3 SV=1 155 232 2.0E-08
sp|Q9CQW1|YKT6_MOUSE Synaptobrevin homolog YKT6 OS=Mus musculus GN=Ykt6 PE=1 SV=1 78 200 3.0E-08
sp|Q6P7L4|SC22B_XENTR Vesicle-trafficking protein SEC22b OS=Xenopus tropicalis GN=sec22b PE=2 SV=1 32 225 4.0E-08
sp|Q2KJD2|VAMP3_BOVIN Vesicle-associated membrane protein 3 OS=Bos taurus GN=VAMP3 PE=3 SV=1 150 215 4.0E-08
sp|Q757A4|YKT6_ASHGO Synaptobrevin homolog YKT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YKT6 PE=3 SV=1 80 200 7.0E-08
sp|Q6FW27|YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YKT6 PE=3 SV=1 131 200 9.0E-08
sp|Q5EGY4|YKT6_RAT Synaptobrevin homolog YKT6 OS=Rattus norvegicus GN=Ykt6 PE=1 SV=1 78 200 1.0E-07
sp|Q6DDU7|YKT6A_XENLA Synaptobrevin homolog YKT6-A OS=Xenopus laevis GN=ykt6-a PE=2 SV=1 80 200 1.0E-07
sp|P47194|SYB_DORPE Synaptobrevin OS=Doryteuthis pealeii PE=1 SV=1 156 217 2.0E-07
sp|Q6P816|YKT6_XENTR Synaptobrevin homolog YKT6 OS=Xenopus tropicalis GN=ykt6 PE=2 SV=1 84 200 2.0E-07
sp|Q32N70|YKT6B_XENLA Synaptobrevin homolog YKT6-B OS=Xenopus laevis GN=ykt6-b PE=2 SV=1 84 200 2.0E-07
sp|Q6C537|YKT6_YARLI Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YKT6 PE=3 SV=1 132 195 3.0E-07
sp|Q6FWT0|SEC22_CANGA Protein transport protein SEC22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC22 PE=3 SV=1 40 196 4.0E-07
sp|Q6CJA0|SEC22_KLULA Protein transport protein SEC22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC22 PE=3 SV=1 38 225 4.0E-07
sp|P36015|YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKT6 PE=1 SV=1 80 200 5.0E-07
sp|Q3T000|YKT6_BOVIN Synaptobrevin homolog YKT6 OS=Bos taurus GN=YKT6 PE=2 SV=1 84 200 7.0E-07
sp|Q94AU2|SEC22_ARATH 25.3 kDa vesicle transport protein OS=Arabidopsis thaliana GN=SEC22 PE=2 SV=1 52 205 8.0E-07
sp|Q6C880|SEC22_YARLI Protein transport protein SEC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC22 PE=3 SV=1 32 207 1.0E-06
sp|Q27236|SYBL_SCHMA Synaptobrevin-like protein OS=Schistosoma mansoni PE=2 SV=1 143 215 1.0E-06
sp|P34351|SNB5_CAEEL Synaptobrevin-like protein 5 OS=Caenorhabditis elegans GN=snb-5 PE=3 SV=1 144 209 2.0E-06
sp|Q74ZD2|SEC22_ASHGO Protein transport protein SEC22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC22 PE=3 SV=2 26 230 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 213 232 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5630
MASSSTAPTPLLYSCIAHKTTILAECTTSASSQTSSLASLILPKIEHTSPQKLTYTHGPHQIHYVAEAPSSHPGA
PSAGGLTFLTVADASLGRRAPFAFLLEARSRFLAHFSPDSTDFADLPNYGAASFNADLRNLMGEYATPGREDDAI
GNAKREIDDVRGIMTKNIESLLERGERLDLLVDKTDRLGGSAREFRVRSRGLKRQMWWKNVKLMALLALVLVLVI
MGITIAVKKS*
Coding >OphauB2|5630
ATGGCGTCATCATCAACGGCTCCCACTCCTCTGCTCTATTCTTGCATTGCGCACAAGACGACAATCCTTGCCGAA
TGCACAACGTCGGCTTCTTCGCAGACCTCATCTCTAGCCTCCCTTATCCTACCCAAAATTGAGCACACTTCTCCC
CAAAAGCTCACCTATACCCATGGCCCGCATCAAATCCACTACGTTGCCGAAGCACCCTCGTCGCACCCTGGCGCG
CCTTCTGCCGGCGGTCTCACCTTTTTAACTGTTGCCGACGCTTCGCTAGGCCGCCGCGCCCCTTTTGCCTTTCTG
CTCGAAGCTCGCTCGCGTTTTCTGGCGCACTTCTCCCCCGACTCGACGGATTTCGCAGACTTGCCAAACTATGGC
GCTGCGTCTTTTAATGCCGACTTGCGAAATCTCATGGGCGAATACGCAACGCCAGGACGCGAGGATGACGCCATC
GGCAACGCTAAGCGAGAAATCGACGACGTCAGAGGCATCATGACAAAGAATATCGAAAGCCTGTTGGAGAGGGGC
GAGAGATTGGATTTGTTGGTGGACAAGACGGACCGGCTGGGTGGCAGCGCGCGCGAGTTTCGTGTTCGCAGTCGG
GGCCTCAAGCGCCAAATGTGGTGGAAAAACGTCAAGCTCATGGCGTTGCTGGCTCTTGTCTTGGTCCTTGTCATT
ATGGGTATAACCATTGCCGTCAAGAAGAGTTGA
Transcript >OphauB2|5630
ATGGCGTCATCATCAACGGCTCCCACTCCTCTGCTCTATTCTTGCATTGCGCACAAGACGACAATCCTTGCCGAA
TGCACAACGTCGGCTTCTTCGCAGACCTCATCTCTAGCCTCCCTTATCCTACCCAAAATTGAGCACACTTCTCCC
CAAAAGCTCACCTATACCCATGGCCCGCATCAAATCCACTACGTTGCCGAAGCACCCTCGTCGCACCCTGGCGCG
CCTTCTGCCGGCGGTCTCACCTTTTTAACTGTTGCCGACGCTTCGCTAGGCCGCCGCGCCCCTTTTGCCTTTCTG
CTCGAAGCTCGCTCGCGTTTTCTGGCGCACTTCTCCCCCGACTCGACGGATTTCGCAGACTTGCCAAACTATGGC
GCTGCGTCTTTTAATGCCGACTTGCGAAATCTCATGGGCGAATACGCAACGCCAGGACGCGAGGATGACGCCATC
GGCAACGCTAAGCGAGAAATCGACGACGTCAGAGGCATCATGACAAAGAATATCGAAAGCCTGTTGGAGAGGGGC
GAGAGATTGGATTTGTTGGTGGACAAGACGGACCGGCTGGGTGGCAGCGCGCGCGAGTTTCGTGTTCGCAGTCGG
GGCCTCAAGCGCCAAATGTGGTGGAAAAACGTCAAGCTCATGGCGTTGCTGGCTCTTGTCTTGGTCCTTGTCATT
ATGGGTATAACCATTGCCGTCAAGAAGAGTTGA
Gene >OphauB2|5630
ATGGCGTCATCATCAACGGCTCCCACTCCTCTGCTCTAGTATGTTGCTTGTCTCGATGGCCTGCAGGAATCAAGG
CTGACATTATTCTACTGTAGTTCTTGCATTGCGCACAAGACGACAATCCTTGCCGAATGCACAACGTCGGCTTCT
TCGCAGACCTCATCTCTAGCCTCCCTTATCCTACCCAAAATTGAGCACACTTCTCCCCAAAAGCTCACCTATACC
CATGGCCCGCATCAAATCCACTACGTTGCCGAAGCACCCTCGTCGCACCCTGGCGCGCCTTCTGCCGGCGGTCTC
ACCTTTTTAACTGTTGCCGACGCTTCGCTAGGCCGCCGCGCCCCTTTTGCCTTTCTGCTCGAAGCTCGCTCGCGT
TTTCTGGCGCACTTCTCCCCCGACTCGACGGATTTCGCAGACTTGCCAAACTATGGCGCTGCGTCTTTTAATGCC
GACTTGCGAAATCTCATGGGCGAATACGCAACGCCAGGACGCGAGGATGACGCCATCGGCAACGCTAAGCGAGAA
ATCGACGACGTCAGAGGCATCATGACAAAGAATATCGAAAGCCTGTTGGAGAGGGGCGAGAGATTGGATTTGTTG
GTGGACAAGACGGACCGGCTGGGTGGCAGCGCGCGCGAGTTTCGTGTTCGCAGTCGGGGCCTCAAGCGCCAAATG
TGGTGGAAAAACGTCAAGCTCATGGCGTTGCTGGCTCTTGTCTTGGTCCTTGTCATTATGGGTATAACCATTGCC
GTCAAGAAGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail