Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5625
Gene name
LocationContig_45:55578..57892
Strand+
Gene length (bp)2314
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup319
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2443
Ophiocordyceps australis map64 (Brazil) OphauB2|5230
Ophiocordyceps australis map64 (Brazil) OphauB2|5625 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2420
Ophiocordyceps kimflemingae Ophio5|5926
Ophiocordyceps subramaniannii Hirsu2|2503
Ophiocordyceps subramaniannii Hirsu2|5702
Ophiocordyceps subramaniannii Hirsu2|6937
Ophiocordyceps subramaniannii Hirsu2|775
Ophiocordyceps subramaniannii Hirsu2|9312

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5625
MMPDIIKAGSEQFKRQNIAEAMNKGAGRAKYETIKGPDFEGFDRKKLWVAKVNNINEKPSQNIRVVYSGDKFVGL
VDVSDPEFCFCSKQKPLSNPPSVQQQLKRAKRANLCSCGEMEERIDENGKKGPRRNQSRKRPSKGENTSTHEAKS
PHSEEAKSSHGEDAKSPSSQEAMGAKDKGSKELEEENTISAQMDRTQKIKTARLANEISDQEFTKLATRRGLDKV
VQEKWQKSLSQVRQLVGYKALDAESPRLSISSLKLGAMGSGGLAIGATMWAASLVDAFTHDTSGWERSEAITAII
PFVGCTTTAAADVAHGSLDSNMVLDTSLCFLGDALLLTPAWPAGVVVHVVRAILSQFTPPDVPSLEAMKKTRDEA
WSKYLDDRVYTFIYSHPRLYREGGFGAQIEATLAIEELAVLSQSAQTIGAVGALGQSVQETHSNENRWRIIANVQ
AAISKTLRATSREIARRQRATLMDIARKLHADTNLSLKTTADRFNEAFSGNMTSWEMVARYTQTYTGDPEIPGMS
LNNQDDVRNELGEIAACLRKTPLKIPSLFELAFVVGQSKGLVALHEETLSIQGYIRAKMSETRGRRASNYQINLI
ALRHTLAVAQLLRGTRQQDALPIDLDNLDAEHVEELHLLITLKYGWIYDDCKSKLTDKLFGGAKHWSREQYGRVF
KFFTHPVKLPIFFEAETVPYIALVLGLEEKLVENLMEEMKQWLMRKNTAHAIFEALSRKAAEAGKKVKELNLEHF
HK*
Coding >OphauB2|5625
ATGATGCCCGATATAATCAAGGCGGGGTCAGAGCAATTCAAGCGTCAGAATATTGCAGAGGCCATGAACAAGGGA
GCAGGACGAGCCAAGTACGAAACCATAAAGGGCCCAGACTTTGAAGGGTTTGACCGCAAGAAGCTGTGGGTGGCA
AAGGTGAATAATATCAATGAGAAGCCATCGCAGAATATTCGCGTAGTTTACAGCGGAGACAAGTTTGTCGGCCTT
GTAGATGTCTCGGACCCCGAATTTTGCTTTTGTTCAAAACAGAAGCCGTTATCAAACCCACCAAGTGTTCAACAA
CAGCTGAAGCGGGCCAAAAGAGCAAATCTTTGCTCCTGCGGCGAAATGGAGGAGAGAATTGACGAGAATGGGAAA
AAGGGGCCTCGTAGAAACCAAAGTCGAAAGAGGCCATCAAAAGGCGAGAATACGTCAACTCACGAGGCCAAGAGC
CCCCACAGTGAAGAGGCCAAGAGCTCTCACGGTGAAGATGCAAAGAGTCCATCCAGTCAAGAGGCCATGGGCGCC
AAAGACAAAGGAAGCAAAGAACTTGAAGAGGAAAACACCATCAGCGCTCAAATGGACCGAACCCAAAAAATCAAG
ACGGCAAGACTAGCCAACGAAATTTCAGACCAAGAGTTTACCAAACTAGCAACTCGGCGAGGTCTTGACAAGGTG
GTCCAAGAAAAGTGGCAAAAGTCGCTCTCGCAAGTGCGCCAGCTAGTCGGCTACAAGGCACTAGACGCCGAGTCG
CCCAGACTCAGCATCAGCAGCTTGAAGCTGGGTGCCATGGGAAGCGGCGGCCTAGCCATTGGCGCAACAATGTGG
GCAGCCAGCCTTGTCGACGCCTTTACCCACGACACGTCGGGCTGGGAGCGCAGCGAGGCCATCACGGCCATTATT
CCCTTTGTCGGCTGCACGACAACCGCAGCGGCCGACGTGGCCCACGGCTCGCTGGACAGCAACATGGTGCTTGAC
ACGTCGCTTTGTTTTCTCGGTGACGCCCTGCTGCTCACGCCAGCCTGGCCGGCGGGAGTGGTGGTGCATGTCGTG
CGAGCTATTCTATCCCAGTTTACTCCACCAGACGTGCCCTCGCTTGAGGCGATGAAGAAGACTCGAGATGAGGCG
TGGAGCAAATATCTTGACGATAGGGTTTACACTTTTATCTACTCGCATCCCCGTCTTTATCGAGAGGGTGGTTTT
GGCGCGCAGATTGAAGCCACGCTGGCTATTGAGGAACTAGCCGTCTTGTCACAGAGCGCGCAGACGATTGGCGCG
GTTGGAGCTCTTGGCCAGAGCGTGCAAGAGACACACTCGAACGAGAACAGGTGGCGGATTATAGCAAATGTACAA
GCGGCCATTAGCAAGACGCTTCGAGCCACGAGCAGGGAGATTGCACGCAGACAGCGAGCCACGTTGATGGACATT
GCGCGCAAACTGCACGCAGACACAAATCTCTCCTTGAAGACGACGGCGGACAGGTTCAACGAGGCCTTTTCGGGG
AATATGACTAGTTGGGAAATGGTGGCTCGGTACACGCAAACATATACCGGGGATCCAGAGATTCCTGGTATGTCG
CTAAACAACCAAGACGATGTGCGCAATGAGCTTGGTGAAATTGCAGCTTGTCTGCGCAAGACGCCGCTAAAGATT
CCTAGCTTGTTTGAGCTTGCCTTTGTTGTTGGGCAGTCCAAGGGGCTCGTGGCGCTACATGAGGAGACGCTCTCG
ATACAAGGCTACATCAGGGCCAAAATGTCAGAGACTAGAGGAAGAAGGGCTAGTAATTATCAAATCAATCTCATT
GCTCTTCGTCACACACTTGCAGTCGCCCAGCTTCTCCGCGGCACCAGGCAACAAGATGCTCTTCCTATAGACTTG
GACAATCTAGACGCCGAGCATGTTGAGGAGCTTCATCTTCTCATCACGCTCAAGTATGGATGGATATACGACGAC
TGCAAGTCAAAGCTCACTGACAAATTGTTTGGGGGCGCCAAGCACTGGTCACGCGAACAGTATGGCCGTGTCTTT
AAGTTTTTCACCCATCCGGTTAAGCTGCCTATTTTCTTTGAGGCAGAGACTGTTCCCTACATTGCGTTGGTGCTT
GGCCTCGAGGAAAAACTTGTTGAAAACTTGATGGAGGAGATGAAGCAATGGTTGATGCGCAAGAATACGGCTCAC
GCCATTTTCGAGGCCCTGAGTAGGAAAGCAGCAGAAGCGGGCAAAAAGGTGAAGGAGTTGAATCTTGAGCATTTT
CATAAGTGA
Transcript >OphauB2|5625
ATGATGCCCGATATAATCAAGGCGGGGTCAGAGCAATTCAAGCGTCAGAATATTGCAGAGGCCATGAACAAGGGA
GCAGGACGAGCCAAGTACGAAACCATAAAGGGCCCAGACTTTGAAGGGTTTGACCGCAAGAAGCTGTGGGTGGCA
AAGGTGAATAATATCAATGAGAAGCCATCGCAGAATATTCGCGTAGTTTACAGCGGAGACAAGTTTGTCGGCCTT
GTAGATGTCTCGGACCCCGAATTTTGCTTTTGTTCAAAACAGAAGCCGTTATCAAACCCACCAAGTGTTCAACAA
CAGCTGAAGCGGGCCAAAAGAGCAAATCTTTGCTCCTGCGGCGAAATGGAGGAGAGAATTGACGAGAATGGGAAA
AAGGGGCCTCGTAGAAACCAAAGTCGAAAGAGGCCATCAAAAGGCGAGAATACGTCAACTCACGAGGCCAAGAGC
CCCCACAGTGAAGAGGCCAAGAGCTCTCACGGTGAAGATGCAAAGAGTCCATCCAGTCAAGAGGCCATGGGCGCC
AAAGACAAAGGAAGCAAAGAACTTGAAGAGGAAAACACCATCAGCGCTCAAATGGACCGAACCCAAAAAATCAAG
ACGGCAAGACTAGCCAACGAAATTTCAGACCAAGAGTTTACCAAACTAGCAACTCGGCGAGGTCTTGACAAGGTG
GTCCAAGAAAAGTGGCAAAAGTCGCTCTCGCAAGTGCGCCAGCTAGTCGGCTACAAGGCACTAGACGCCGAGTCG
CCCAGACTCAGCATCAGCAGCTTGAAGCTGGGTGCCATGGGAAGCGGCGGCCTAGCCATTGGCGCAACAATGTGG
GCAGCCAGCCTTGTCGACGCCTTTACCCACGACACGTCGGGCTGGGAGCGCAGCGAGGCCATCACGGCCATTATT
CCCTTTGTCGGCTGCACGACAACCGCAGCGGCCGACGTGGCCCACGGCTCGCTGGACAGCAACATGGTGCTTGAC
ACGTCGCTTTGTTTTCTCGGTGACGCCCTGCTGCTCACGCCAGCCTGGCCGGCGGGAGTGGTGGTGCATGTCGTG
CGAGCTATTCTATCCCAGTTTACTCCACCAGACGTGCCCTCGCTTGAGGCGATGAAGAAGACTCGAGATGAGGCG
TGGAGCAAATATCTTGACGATAGGGTTTACACTTTTATCTACTCGCATCCCCGTCTTTATCGAGAGGGTGGTTTT
GGCGCGCAGATTGAAGCCACGCTGGCTATTGAGGAACTAGCCGTCTTGTCACAGAGCGCGCAGACGATTGGCGCG
GTTGGAGCTCTTGGCCAGAGCGTGCAAGAGACACACTCGAACGAGAACAGGTGGCGGATTATAGCAAATGTACAA
GCGGCCATTAGCAAGACGCTTCGAGCCACGAGCAGGGAGATTGCACGCAGACAGCGAGCCACGTTGATGGACATT
GCGCGCAAACTGCACGCAGACACAAATCTCTCCTTGAAGACGACGGCGGACAGGTTCAACGAGGCCTTTTCGGGG
AATATGACTAGTTGGGAAATGGTGGCTCGGTACACGCAAACATATACCGGGGATCCAGAGATTCCTGGTATGTCG
CTAAACAACCAAGACGATGTGCGCAATGAGCTTGGTGAAATTGCAGCTTGTCTGCGCAAGACGCCGCTAAAGATT
CCTAGCTTGTTTGAGCTTGCCTTTGTTGTTGGGCAGTCCAAGGGGCTCGTGGCGCTACATGAGGAGACGCTCTCG
ATACAAGGCTACATCAGGGCCAAAATGTCAGAGACTAGAGGAAGAAGGGCTAGTAATTATCAAATCAATCTCATT
GCTCTTCGTCACACACTTGCAGTCGCCCAGCTTCTCCGCGGCACCAGGCAACAAGATGCTCTTCCTATAGACTTG
GACAATCTAGACGCCGAGCATGTTGAGGAGCTTCATCTTCTCATCACGCTCAAGTATGGATGGATATACGACGAC
TGCAAGTCAAAGCTCACTGACAAATTGTTTGGGGGCGCCAAGCACTGGTCACGCGAACAGTATGGCCGTGTCTTT
AAGTTTTTCACCCATCCGGTTAAGCTGCCTATTTTCTTTGAGGCAGAGACTGTTCCCTACATTGCGTTGGTGCTT
GGCCTCGAGGAAAAACTTGTTGAAAACTTGATGGAGGAGATGAAGCAATGGTTGATGCGCAAGAATACGGCTCAC
GCCATTTTCGAGGCCCTGAGTAGGAAAGCAGCAGAAGCGGGCAAAAAGGTGAAGGAGTTGAATCTTGAGCATTTT
CATAAGTGA
Gene >OphauB2|5625
ATGATGCCCGATATAATCAAGGCGGGGTCAGAGCAATTCAAGCGTCAGAATATTGCAGAGGCCATGAACAAGGGA
GCAGGACGAGCCAAGTACGAAACCATAAAGGGCCCAGACTTTGAAGGGTTTGACCGCAAGAAGCTGTGGGTGGCA
AAGGTGAATAATATCAATGGTAAGTTGCGATAAATCTTGCTGTTTTGGCGCATGCTAATGATTTGGAAACATAGA
GAAGCCATCGCAGAATATTCGCGTAGTTTACAGCGGAGACAAGTTTGTCGGCCTTGTAGATGTCTCGGACCCCGA
ATTTTGCTTTTGTTCAAAACAGAAGCCGTTATCAAACCCACCAAGTGTTCAACAACAGCTGAAGCGGGCCAAAAG
AGCAAATCTTTGCTCCTGCGGCGAAATGGAGGAGAGAATTGACGAGAATGGGAAAAAGGGGCCTCGTAGAAACCA
AAGTCGAAAGAGGCCATCAAAAGGCGAGAATACGTCAACTCACGAGGCCAAGAGCCCCCACAGTGAAGAGGCCAA
GAGCTCTCACGGTGAAGATGCAAAGAGTCCATCCAGTCAAGAGGCCATGGGCGCCAAAGACAAAGGAAGCAAAGA
ACTTGAAGAGGAAAACACCATCAGCGCTCAAATGGACCGAACCCAAAAAATCAAGACGGCAAGACTAGCCAACGA
AATTTCAGACCAAGAGTTTACCAAACTAGCAACTCGGCGAGGTCTTGACAAGGTGGTCCAAGAAAAGTGGCAAAA
GTCGCTCTCGCAAGTGCGCCAGCTAGTCGGCTACAAGGCACTAGACGCCGAGTCGCCCAGACTCAGCATCAGCAG
CTTGAAGCTGGGTGCCATGGGAAGCGGCGGCCTAGCCATTGGCGCAACAATGTGGGCAGCCAGCCTTGTCGACGC
CTTTACCCACGACACGTCGGGCTGGGAGCGCAGCGAGGCCATCACGGCCATTATTCCCTTTGTCGGCTGCACGAC
AACCGCAGCGGCCGACGTGGCCCACGGCTCGCTGGACAGCAACATGGTGCTTGACACGTCGCTTTGTTTTCTCGG
TGACGCCCTGCTGCTCACGCCAGCCTGGCCGGCGGGAGTGGTGGTGCATGTCGTGCGAGCTATTCTATCCCAGTT
TACTCCACCAGACGTGCCCTCGCTTGAGGCGATGAAGAAGACTCGAGATGAGGCGTGGAGCAAATATCTTGACGA
TAGGGTTTACACTTTTATCTACTCGCATCCCCGTCTTTATCGAGAGGGTGGTTTTGGCGCGCAGATTGAAGCCAC
GCTGGCTATTGAGGAACTAGCCGTCTTGTCACAGAGCGCGCAGACGATTGGCGCGGTTGGAGCTCTTGGCCAGAG
CGTGCAAGAGACACACTCGAACGAGAACAGGTGGCGGATTATAGCAAATGTACAAGCGGCCATTAGCAAGACGCT
TCGAGCCACGAGCAGGGAGATTGCACGCAGACAGCGAGCCACGTTGATGGACATTGCGCGCAAACTGCACGCAGA
CACAAATCTCTCCTTGAAGACGACGGCGGACAGGTTCAACGAGGCCTTTTCGGGGAATATGACTAGTTGGGAAAT
GGTGGCTCGGTACACGCAAACATATACCGGGGATCCAGAGATTCCTGGTATGTCGCTAAACAACCAAGACGATGT
GCGCAATGAGCTTGGTGAAATTGCAGCTTGTCTGCGCAAGACGCCGCTAAAGATTCCTAGCTTGTTTGAGCTTGC
CTTTGTTGTTGGGCAGTCCAAGGGGCTCGTGGCGCTACATGAGGAGACGCTCTCGATACAAGGCTACATCAGGGC
CAAAATGTCAGAGACTAGAGGAAGAAGGGCTAGTAATTATCAAATCAATCTCATTGCTCTTCGTCACACACTTGC
AGTCGCCCAGCTTCTCCGCGGCACCAGGCAACAAGATGCTCTTCCTATAGACTTGGACAATCTAGACGCCGAGCA
TGTTGAGGAGCTTCATCTTCTCATCACGCTCAAGTATGGATGGATATACGACGACTGCAAGTCAAAGCTCACTGA
CAAATTGTTTGGGGGCGCCAAGCACTGGTCACGCGAACAGTATGGCCGTGTCTTTAAGTTTTTCACCCATCCGGT
TAAGCTGCCTATTTTCTTTGAGGCAGAGACTGTTCCCTACATTGCGTTGGTGCTTGGCCTCGAGGAAAAACTTGT
TGAAAACTTGATGGAGGAGATGAAGCAATGGTTGATGCGCAAGAATACGGCTCACGCCATTTTCGAGGCCCTGAG
TAGGAAAGCAGCAGAAGCGGGCAAAAAGGTGAAGGAGTTGAATCTTGAGCATTTTCATAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail