Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5624
Gene name
LocationContig_45:53703..54451
Strand+
Gene length (bp)748
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05241 EBP EXPERA (EXPanded EBP superfamily) 7.4E-23 92 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P70245|EBP_MOUSE 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Mus musculus GN=Ebp PE=1 SV=3 3 206 1.0E-42
sp|Q15125|EBP_HUMAN 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens GN=EBP PE=1 SV=3 3 206 7.0E-42
sp|Q60490|EBP_CAVPO 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Cavia porcellus GN=EBP PE=1 SV=3 3 206 1.0E-41
sp|Q9JJ46|EBP_RAT 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Rattus norvegicus GN=Ebp PE=2 SV=3 6 223 5.0E-39
sp|Q9FTZ2|EBP_ORYSJ Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Oryza sativa subsp. japonica GN=Os01g0103600 PE=2 SV=1 8 215 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P70245|EBP_MOUSE 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Mus musculus GN=Ebp PE=1 SV=3 3 206 1.0E-42
sp|Q15125|EBP_HUMAN 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens GN=EBP PE=1 SV=3 3 206 7.0E-42
sp|Q60490|EBP_CAVPO 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Cavia porcellus GN=EBP PE=1 SV=3 3 206 1.0E-41
sp|Q9JJ46|EBP_RAT 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Rattus norvegicus GN=Ebp PE=2 SV=3 6 223 5.0E-39
sp|Q9FTZ2|EBP_ORYSJ Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Oryza sativa subsp. japonica GN=Os01g0103600 PE=2 SV=1 8 215 4.0E-27
sp|O48962|EBP_ARATH Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Arabidopsis thaliana GN=At1g20050 PE=2 SV=1 8 202 7.0E-21
sp|Q9D0P0|EBPL_MOUSE Emopamil-binding protein-like OS=Mus musculus GN=Ebpl PE=2 SV=1 57 223 2.0E-20
sp|Q9BY08|EBPL_HUMAN Emopamil-binding protein-like OS=Homo sapiens GN=EBPL PE=1 SV=1 51 223 1.0E-15
sp|Q55E32|EBP_DICDI Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Dictyostelium discoideum GN=ebp PE=2 SV=1 60 222 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 61 83 22
3 115 137 22
4 149 171 22
5 186 208 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5624
MASSTPMHPYYPLGVSIPDYTPKTLNTRTILAIFVTACSGVLVPAFILIRRARPSLSTSEVATAMWFLLCGFIHV
VLEGNFALHSVADSSTILSQLWKEYALSDSRYLTRDAFTVCMETITAFAWGPLSFLLVRLILDAHPARHTVQTVI
SLGQLYGVVLYYATFVHDIAVRGIHYSRPEKRYLYGYMVLTNSFWVVIPAFLLVQSGLATMAAFSRAANMVKKD*
Coding >OphauB2|5624
ATGGCCAGCAGCACGCCCATGCACCCATACTACCCTTTGGGAGTCTCAATCCCAGACTATACGCCCAAGACACTC
AATACCAGGACAATTTTAGCAATATTTGTTACCGCTTGCTCGGGCGTCCTGGTGCCAGCATTCATCTTGATTCGA
CGTGCGCGTCCAAGTCTCTCGACTAGCGAGGTGGCCACGGCAATGTGGTTTCTGCTTTGCGGCTTCATCCATGTA
GTCCTCGAAGGCAATTTTGCCCTCCACAGCGTCGCAGACAGTTCCACGATTCTCTCCCAGCTCTGGAAGGAGTAT
GCGCTATCCGACTCGCGGTACTTGACTCGAGACGCATTTACGGTTTGTATGGAGACCATTACCGCCTTTGCTTGG
GGACCGCTTTCGTTTCTCCTCGTCCGCCTCATACTAGACGCCCATCCGGCTCGGCACACTGTGCAAACAGTCATT
AGTCTGGGCCAGTTATACGGTGTGGTGTTATACTATGCAACATTTGTTCACGACATTGCGGTGCGTGGGATTCAC
TATTCTCGGCCAGAAAAGCGTTATCTATACGGTTACATGGTTCTTACAAACTCCTTTTGGGTTGTCATTCCTGCA
TTTTTGCTCGTGCAGTCTGGCTTGGCGACAATGGCGGCTTTTTCTAGGGCGGCCAATATGGTAAAGAAGGATTGA
Transcript >OphauB2|5624
ATGGCCAGCAGCACGCCCATGCACCCATACTACCCTTTGGGAGTCTCAATCCCAGACTATACGCCCAAGACACTC
AATACCAGGACAATTTTAGCAATATTTGTTACCGCTTGCTCGGGCGTCCTGGTGCCAGCATTCATCTTGATTCGA
CGTGCGCGTCCAAGTCTCTCGACTAGCGAGGTGGCCACGGCAATGTGGTTTCTGCTTTGCGGCTTCATCCATGTA
GTCCTCGAAGGCAATTTTGCCCTCCACAGCGTCGCAGACAGTTCCACGATTCTCTCCCAGCTCTGGAAGGAGTAT
GCGCTATCCGACTCGCGGTACTTGACTCGAGACGCATTTACGGTTTGTATGGAGACCATTACCGCCTTTGCTTGG
GGACCGCTTTCGTTTCTCCTCGTCCGCCTCATACTAGACGCCCATCCGGCTCGGCACACTGTGCAAACAGTCATT
AGTCTGGGCCAGTTATACGGTGTGGTGTTATACTATGCAACATTTGTTCACGACATTGCGGTGCGTGGGATTCAC
TATTCTCGGCCAGAAAAGCGTTATCTATACGGTTACATGGTTCTTACAAACTCCTTTTGGGTTGTCATTCCTGCA
TTTTTGCTCGTGCAGTCTGGCTTGGCGACAATGGCGGCTTTTTCTAGGGCGGCCAATATGGTAAAGAAGGATTGA
Gene >OphauB2|5624
ATGGCCAGCAGCACGCCCATGCACCCATACTACCCTTTGGGAGTCTCAATCCCAGACTATACGCCCAAGACACTC
AATACCAGGACAATTTTAGCAATATTTGTTACCGCTTGCTCGGGCGTCCTGGTGCCAGCATTCATCTTGATTCGA
CGTGCGCGTCCAAGTCTCTCGACTAGCGAGGTGGCCACGGCAATGTGGTTTCTGCTTTGCGGCTTCATCCATGTA
GTCCTCGAAGGTAGGTTCTTGTTTCCTGCTTGCCGACTTGCGCTTTGGGTGTCTAGAATCTAACTTTTGCCATGT
TGCTACAGGCAATTTTGCCCTCCACAGCGTCGCAGACAGTTCCACGATTCTCTCCCAGCTCTGGAAGGAGTATGC
GCTATCCGACTCGCGGTACTTGACTCGAGACGCATTTACGGTTTGTATGGAGACCATTACCGCCTTTGCTTGGGG
ACCGCTTTCGTTTCTCCTCGTCCGCCTCATACTAGACGCCCATCCGGCTCGGCACACTGTGCAAACAGTCATTAG
TCTGGGCCAGTTATACGGTGTGGTGTTATACTATGCAACATTTGTTCACGACATTGCGGTGCGTGGGATTCACTA
TTCTCGGCCAGAAAAGCGTTATCTATACGGTTACATGGTTCTTACAAACTCCTTTTGGGTTGTCATTCCTGCATT
TTTGCTCGTGCAGTCTGGCTTGGCGACAATGGCGGCTTTTTCTAGGGCGGCCAATATGGTAAAGAAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail