Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5615
Gene name
LocationContig_45:31470..32031
Strand-
Gene length (bp)561
Transcript length (bp)507
Coding sequence length (bp)507
Protein length (aa) 169

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01679 Pmp3 Proteolipid membrane potential modulator 4.7E-18 5 53

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1W4|PMP3_SCHPO Plasma membrane proteolipid 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp3 PE=3 SV=2 4 56 1.0E-12
sp|O74837|PMP31_SCHPO Plasma membrane proteolipid 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp31 PE=1 SV=2 4 57 2.0E-10
sp|Q871V2|PMP3_NEUCR Plasma membrane proteolipid 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pmp-1 PE=3 SV=1 3 56 4.0E-10
sp|Q4HXT6|PMP3_GIBZE Plasma membrane proteolipid 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PMP3 PE=3 SV=2 3 56 1.0E-09
sp|P34655|YOT0_CAEEL UPF0057 membrane protein ZK632.10 OS=Caenorhabditis elegans GN=ZK632.10 PE=3 SV=2 6 53 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1W4|PMP3_SCHPO Plasma membrane proteolipid 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp3 PE=3 SV=2 4 56 1.0E-12
sp|O74837|PMP31_SCHPO Plasma membrane proteolipid 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp31 PE=1 SV=2 4 57 2.0E-10
sp|Q871V2|PMP3_NEUCR Plasma membrane proteolipid 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pmp-1 PE=3 SV=1 3 56 4.0E-10
sp|Q4HXT6|PMP3_GIBZE Plasma membrane proteolipid 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PMP3 PE=3 SV=2 3 56 1.0E-09
sp|P34655|YOT0_CAEEL UPF0057 membrane protein ZK632.10 OS=Caenorhabditis elegans GN=ZK632.10 PE=3 SV=2 6 53 2.0E-09
sp|Q4WYA5|PMP3_ASPFU Plasma membrane proteolipid 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pmp3 PE=3 SV=1 3 56 9.0E-09
sp|Q9LRI7|OSR8_ORYSJ Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica GN=OSR8 PE=3 SV=1 10 67 1.0E-07
sp|Q9M095|RC23_ARATH UPF0057 membrane protein At4g30650 OS=Arabidopsis thaliana GN=At4g30650 PE=3 SV=1 10 54 3.0E-07
sp|Q22702|YCU5_CAEEL UPF0057 membrane protein T23F2.5 OS=Caenorhabditis elegans GN=T23F2.5 PE=3 SV=1 12 56 2.0E-06
sp|Q9SUI0|RC24_ARATH UPF0057 membrane protein At4g30660 OS=Arabidopsis thaliana GN=At4g30660 PE=2 SV=1 10 54 6.0E-06
sp|P0CS18|PMP3_CRYNJ Plasma membrane proteolipid 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PMP3 PE=3 SV=1 4 56 6.0E-06
sp|P0CS19|PMP3_CRYNB Plasma membrane proteolipid 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PMP3 PE=3 SV=1 4 56 6.0E-06
sp|Q6BVN0|PMP3_DEBHA Plasma membrane proteolipid 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PMP3 PE=3 SV=1 15 56 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 32 54 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5615
MCSADIFLGVIAILFPPLPVWVKRGICSADSIINILLCVLGILPGLIHSWYIIAKYPDDPYEYETLGNEAGERVV
WVQVAPPPGSGCRRCSHSCRGSSHHQQRSSQQKKHKHSRHQSQPQQQQPEPPAAMNYGTQGASSAAAGSSNGQGV
PPSYAEVVAGDHKIQTAD*
Coding >OphauB2|5615
ATGTGCTCCGCCGATATTTTCCTTGGCGTAATTGCCATTCTCTTCCCTCCTCTTCCAGTCTGGGTCAAGCGCGGC
ATCTGTAGCGCCGACTCCATCATCAACATCCTTCTCTGCGTCCTTGGAATTCTCCCCGGCCTCATCCACTCGTGG
TACATTATTGCAAAGTATCCCGACGACCCGTACGAGTACGAGACGCTTGGCAACGAGGCTGGCGAGCGTGTTGTC
TGGGTTCAGGTTGCTCCGCCCCCTGGAAGTGGCTGTCGCCGTTGCTCCCACTCCTGCCGCGGCTCATCACACCAC
CAGCAGCGCTCCTCGCAACAAAAGAAGCACAAGCATTCTCGCCACCAGTCGCAACCACAGCAACAACAGCCAGAA
CCACCCGCTGCCATGAACTACGGCACTCAGGGAGCAAGCTCAGCCGCCGCAGGCTCTTCAAACGGCCAGGGTGTT
CCACCATCATATGCAGAGGTTGTGGCTGGCGATCACAAGATACAGACGGCCGACTAG
Transcript >OphauB2|5615
ATGTGCTCCGCCGATATTTTCCTTGGCGTAATTGCCATTCTCTTCCCTCCTCTTCCAGTCTGGGTCAAGCGCGGC
ATCTGTAGCGCCGACTCCATCATCAACATCCTTCTCTGCGTCCTTGGAATTCTCCCCGGCCTCATCCACTCGTGG
TACATTATTGCAAAGTATCCCGACGACCCGTACGAGTACGAGACGCTTGGCAACGAGGCTGGCGAGCGTGTTGTC
TGGGTTCAGGTTGCTCCGCCCCCTGGAAGTGGCTGTCGCCGTTGCTCCCACTCCTGCCGCGGCTCATCACACCAC
CAGCAGCGCTCCTCGCAACAAAAGAAGCACAAGCATTCTCGCCACCAGTCGCAACCACAGCAACAACAGCCAGAA
CCACCCGCTGCCATGAACTACGGCACTCAGGGAGCAAGCTCAGCCGCCGCAGGCTCTTCAAACGGCCAGGGTGTT
CCACCATCATATGCAGAGGTTGTGGCTGGCGATCACAAGATACAGACGGCCGACTAG
Gene >OphauB2|5615
ATGTGCTCCGCCGATATTTTCCTTGGCGTAATTGCCATTCTCTTCCCTCCTCTTCCAGGTACGTGAGCCCTTTAC
CAAGTCATTGCTCCCGTCCAGCTCACACGTGCCGTAGTCTGGGTCAAGCGCGGCATCTGTAGCGCCGACTCCATC
ATCAACATCCTTCTCTGCGTCCTTGGAATTCTCCCCGGCCTCATCCACTCGTGGTACATTATTGCAAAGTATCCC
GACGACCCGTACGAGTACGAGACGCTTGGCAACGAGGCTGGCGAGCGTGTTGTCTGGGTTCAGGTTGCTCCGCCC
CCTGGAAGTGGCTGTCGCCGTTGCTCCCACTCCTGCCGCGGCTCATCACACCACCAGCAGCGCTCCTCGCAACAA
AAGAAGCACAAGCATTCTCGCCACCAGTCGCAACCACAGCAACAACAGCCAGAACCACCCGCTGCCATGAACTAC
GGCACTCAGGGAGCAAGCTCAGCCGCCGCAGGCTCTTCAAACGGCCAGGGTGTTCCACCATCATATGCAGAGGTT
GTGGCTGGCGATCACAAGATACAGACGGCCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail