Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5605
Gene name
LocationContig_45:2018..3647
Strand-
Gene length (bp)1629
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 3.8E-10 134 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8T9S7|PTEN_DICDI Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Dictyostelium discoideum GN=pteN PE=2 SV=1 1 241 3.0E-30
sp|P60484|PTEN_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens GN=PTEN PE=1 SV=1 1 217 1.0E-27
sp|P60483|PTEN_CANLF Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Canis lupus familiaris GN=PTEN PE=2 SV=1 1 217 1.0E-27
sp|O08586|PTEN_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Mus musculus GN=Pten PE=1 SV=1 1 217 1.0E-27
sp|Q9FLZ5|PTEN1_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1 OS=Arabidopsis thaliana GN=PTEN1 PE=1 SV=1 3 204 3.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8T9S7|PTEN_DICDI Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Dictyostelium discoideum GN=pteN PE=2 SV=1 1 241 3.0E-30
sp|P60484|PTEN_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens GN=PTEN PE=1 SV=1 1 217 1.0E-27
sp|P60483|PTEN_CANLF Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Canis lupus familiaris GN=PTEN PE=2 SV=1 1 217 1.0E-27
sp|O08586|PTEN_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Mus musculus GN=Pten PE=1 SV=1 1 217 1.0E-27
sp|Q9FLZ5|PTEN1_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1 OS=Arabidopsis thaliana GN=PTEN1 PE=1 SV=1 3 204 3.0E-26
sp|O94526|PTEN_SCHPO Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase ptn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptn1 PE=3 SV=1 13 199 9.0E-26
sp|Q54JL7|CNRN_DICDI Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase cnrN OS=Dictyostelium discoideum GN=cnrN PE=1 SV=1 3 198 8.0E-25
sp|Q9PUT6|PTEN_XENLA Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Xenopus laevis GN=pten PE=2 SV=1 1 217 2.0E-23
sp|P53916|TEP1_YEAST Probable phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEP1 PE=3 SV=1 2 197 2.0E-22
sp|Q9LT75|PTN2A_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A OS=Arabidopsis thaliana GN=PTEN2A PE=1 SV=1 6 200 3.0E-22
sp|Q6XPS3|TPTE2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Homo sapiens GN=TPTE2 PE=1 SV=2 1 198 4.0E-22
sp|Q4R6N0|TPTE2_MACFA Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Macaca fascicularis GN=TPTE2 PE=2 SV=1 1 204 6.0E-22
sp|Q8H106|PTN2B_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2B OS=Arabidopsis thaliana GN=PTEN2B PE=2 SV=1 6 200 4.0E-21
sp|P56180|TPTE_HUMAN Putative tyrosine-protein phosphatase TPTE OS=Homo sapiens GN=TPTE PE=2 SV=3 1 198 3.0E-19
sp|Q5SSZ5|TENS3_MOUSE Tensin-3 OS=Mus musculus GN=Tns3 PE=1 SV=1 21 198 7.0E-16
sp|Q68CZ2|TENS3_HUMAN Tensin-3 OS=Homo sapiens GN=TNS3 PE=1 SV=2 20 198 1.0E-15
sp|Q9HBL0|TENS1_HUMAN Tensin-1 OS=Homo sapiens GN=TNS1 PE=1 SV=2 21 224 6.0E-14
sp|Q04205|TENS_CHICK Tensin OS=Gallus gallus GN=TNS PE=1 SV=2 21 198 9.0E-14
sp|Q9GLM4|TENS1_BOVIN Tensin-1 OS=Bos taurus GN=TNS1 PE=2 SV=1 21 224 1.0E-13
sp|Q8CGB6|TNS2_MOUSE Tensin-2 OS=Mus musculus GN=Tns2 PE=1 SV=1 21 199 2.0E-12
sp|Q63HR2|TNS2_HUMAN Tensin-2 OS=Homo sapiens GN=TNS2 PE=1 SV=2 21 199 5.0E-12
sp|O14976|GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens GN=GAK PE=1 SV=2 14 198 2.0E-09
sp|Q80TZ3|AUXI_MOUSE Putative tyrosine-protein phosphatase auxilin OS=Mus musculus GN=Dnajc6 PE=1 SV=2 14 221 2.0E-09
sp|Q27974|AUXI_BOVIN Putative tyrosine-protein phosphatase auxilin OS=Bos taurus GN=DNAJC6 PE=1 SV=1 16 221 3.0E-09
sp|P97874|GAK_RAT Cyclin-G-associated kinase OS=Rattus norvegicus GN=Gak PE=1 SV=1 14 198 4.0E-09
sp|Q99KY4|GAK_MOUSE Cyclin-G-associated kinase OS=Mus musculus GN=Gak PE=1 SV=2 14 198 6.0E-09
sp|O75061|AUXI_HUMAN Putative tyrosine-protein phosphatase auxilin OS=Homo sapiens GN=DNAJC6 PE=1 SV=3 16 221 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0006793 phosphorus metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016787 hydrolase activity No
GO:0004721 phosphoprotein phosphatase activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1402
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1681
Ophiocordyceps australis map64 (Brazil) OphauB2|5605 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06270
Ophiocordyceps camponoti-rufipedis Ophun1|1705
Ophiocordyceps kimflemingae Ophio5|4666
Ophiocordyceps subramaniannii Hirsu2|10887

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5605
MASLLRQLVAGPRARHAEAGLDLCYVTDEMIATSGPSQAYPQRAYRNPLDQLVCFLDAKHGDGWAIWEFRAEGTG
YPDEAVYGRVRHYPWPDHHPPPFRLMPLILAGMRNWLKGGPLEEEAKKEEDEDKKGEEDKKRVVVVHCKAGKGRS
GTVACSYLIAEEGWKADDALARFTQRRMRPRFGAGVSIPSQLRWVSYIDRWAKLGRKHYVDRPVEVLEIHVWGLR
HGVKVSVEGFIDNGRNIYTYHTFSKPERIVVEAAPPTGWGFADLVWELAGYPGDSTSMTRPDDDDANKPNRRSRR
ASLIGHDAASSTKPKPSSSSSSTSSSSSSSRTDKTRRKTPPDQEAEPGGMAVILRPHTPILIPHSDINIATERRS
RTNPNVGLTMVSAVAHVWFNAYFEGAGPEECAAGRPAATSGVFSISWDDMDGIKGSSRKGARALDRLAVVWRVAE
GARGDEVPEPETGGAVRQFEAADWTGGRGEGKEQRGGEEEEEEEMEGVRCSGPAGEEPLEQEGAKQ*
Coding >OphauB2|5605
ATGGCGTCGCTTTTGCGGCAGCTTGTTGCGGGACCGCGGGCGAGGCATGCAGAGGCAGGTCTTGACTTGTGCTAT
GTGACGGACGAGATGATTGCAACATCAGGTCCATCGCAAGCGTACCCCCAGCGCGCATACCGCAACCCGCTCGAC
CAGCTTGTCTGCTTCTTGGACGCCAAGCACGGCGACGGGTGGGCGATATGGGAGTTTAGGGCCGAGGGGACGGGG
TATCCGGACGAGGCGGTGTATGGACGCGTGAGGCACTATCCGTGGCCAGATCATCATCCGCCGCCGTTTAGGTTG
ATGCCCTTGATTTTGGCGGGCATGAGGAATTGGCTTAAGGGGGGGCCGTTGGAGGAGGAGGCCAAGAAGGAGGAG
GACGAGGACAAGAAGGGGGAGGAGGACAAGAAGCGCGTCGTGGTGGTGCACTGCAAGGCTGGCAAGGGCCGCAGC
GGCACCGTGGCATGCAGCTACCTCATTGCCGAAGAGGGATGGAAGGCCGACGACGCCCTGGCCCGCTTCACGCAG
CGGCGCATGCGGCCTCGCTTTGGCGCAGGCGTGTCGATTCCGTCGCAGCTGCGGTGGGTGAGCTACATTGACCGC
TGGGCCAAGCTTGGACGCAAACACTATGTCGACCGGCCCGTCGAGGTGCTCGAGATTCACGTCTGGGGCCTGCGC
CACGGCGTCAAGGTGAGCGTCGAGGGCTTCATTGACAATGGCCGCAACATTTATACCTACCACACCTTTTCCAAG
CCAGAGCGCATAGTCGTCGAGGCGGCGCCCCCCACGGGCTGGGGGTTTGCAGACTTGGTGTGGGAGCTGGCGGGA
TACCCAGGCGACTCGACGAGCATGACGCGCCCCGACGACGACGATGCCAACAAACCTAATCGTAGGAGCCGGCGC
GCCAGCCTAATAGGCCACGACGCCGCCTCGTCTACCAAGCCAAAGCCCAGCAGCTCCTCCAGCTCCACATCCTCA
TCATCATCCTCCTCCCGCACCGACAAGACGCGTCGCAAAACGCCTCCCGACCAAGAAGCAGAGCCGGGCGGCATG
GCCGTCATTCTCCGGCCCCACACCCCCATCCTCATCCCCCACAGCGACATCAACATTGCCACGGAGCGCCGCAGC
CGCACCAACCCCAACGTCGGCCTCACCATGGTGTCCGCCGTGGCGCACGTCTGGTTCAATGCCTACTTTGAAGGC
GCCGGGCCAGAGGAGTGCGCTGCCGGCCGCCCCGCTGCAACAAGCGGCGTCTTTTCCATCTCGTGGGACGACATG
GACGGCATCAAGGGCTCTAGCCGCAAGGGGGCGCGCGCGCTGGATCGGCTGGCGGTGGTGTGGCGCGTGGCTGAG
GGGGCGCGTGGCGATGAGGTGCCGGAGCCGGAGACGGGGGGTGCGGTGAGGCAGTTTGAGGCGGCGGATTGGACG
GGTGGGAGGGGGGAGGGCAAGGAGCAGAGAGGAGGAGAGGAGGAGGAGGAGGAGGAGATGGAGGGAGTGCGGTGT
AGTGGGCCGGCGGGCGAGGAGCCGCTCGAGCAAGAGGGTGCAAAGCAGTAA
Transcript >OphauB2|5605
ATGGCGTCGCTTTTGCGGCAGCTTGTTGCGGGACCGCGGGCGAGGCATGCAGAGGCAGGTCTTGACTTGTGCTAT
GTGACGGACGAGATGATTGCAACATCAGGTCCATCGCAAGCGTACCCCCAGCGCGCATACCGCAACCCGCTCGAC
CAGCTTGTCTGCTTCTTGGACGCCAAGCACGGCGACGGGTGGGCGATATGGGAGTTTAGGGCCGAGGGGACGGGG
TATCCGGACGAGGCGGTGTATGGACGCGTGAGGCACTATCCGTGGCCAGATCATCATCCGCCGCCGTTTAGGTTG
ATGCCCTTGATTTTGGCGGGCATGAGGAATTGGCTTAAGGGGGGGCCGTTGGAGGAGGAGGCCAAGAAGGAGGAG
GACGAGGACAAGAAGGGGGAGGAGGACAAGAAGCGCGTCGTGGTGGTGCACTGCAAGGCTGGCAAGGGCCGCAGC
GGCACCGTGGCATGCAGCTACCTCATTGCCGAAGAGGGATGGAAGGCCGACGACGCCCTGGCCCGCTTCACGCAG
CGGCGCATGCGGCCTCGCTTTGGCGCAGGCGTGTCGATTCCGTCGCAGCTGCGGTGGGTGAGCTACATTGACCGC
TGGGCCAAGCTTGGACGCAAACACTATGTCGACCGGCCCGTCGAGGTGCTCGAGATTCACGTCTGGGGCCTGCGC
CACGGCGTCAAGGTGAGCGTCGAGGGCTTCATTGACAATGGCCGCAACATTTATACCTACCACACCTTTTCCAAG
CCAGAGCGCATAGTCGTCGAGGCGGCGCCCCCCACGGGCTGGGGGTTTGCAGACTTGGTGTGGGAGCTGGCGGGA
TACCCAGGCGACTCGACGAGCATGACGCGCCCCGACGACGACGATGCCAACAAACCTAATCGTAGGAGCCGGCGC
GCCAGCCTAATAGGCCACGACGCCGCCTCGTCTACCAAGCCAAAGCCCAGCAGCTCCTCCAGCTCCACATCCTCA
TCATCATCCTCCTCCCGCACCGACAAGACGCGTCGCAAAACGCCTCCCGACCAAGAAGCAGAGCCGGGCGGCATG
GCCGTCATTCTCCGGCCCCACACCCCCATCCTCATCCCCCACAGCGACATCAACATTGCCACGGAGCGCCGCAGC
CGCACCAACCCCAACGTCGGCCTCACCATGGTGTCCGCCGTGGCGCACGTCTGGTTCAATGCCTACTTTGAAGGC
GCCGGGCCAGAGGAGTGCGCTGCCGGCCGCCCCGCTGCAACAAGCGGCGTCTTTTCCATCTCGTGGGACGACATG
GACGGCATCAAGGGCTCTAGCCGCAAGGGGGCGCGCGCGCTGGATCGGCTGGCGGTGGTGTGGCGCGTGGCTGAG
GGGGCGCGTGGCGATGAGGTGCCGGAGCCGGAGACGGGGGGTGCGGTGAGGCAGTTTGAGGCGGCGGATTGGACG
GGTGGGAGGGGGGAGGGCAAGGAGCAGAGAGGAGGAGAGGAGGAGGAGGAGGAGGAGATGGAGGGAGTGCGGTGT
AGTGGGCCGGCGGGCGAGGAGCCGCTCGAGCAAGAGGGTGCAAAGCAGTAA
Gene >OphauB2|5605
ATGGCGTCGCTTTTGCGGCAGCTTGTTGCGGGACCGCGGGCGAGGCATGCAGAGGCAGGTCTTGACTTGTGCTAT
GTGACGGACGAGATGATTGCAACGTGAGCAGGCCACCTTTTTTTCCCTCCCTCTCTTCTCTGTCGCACAAGTGAT
ATCTCCGCAGCTAACAAGGGCCATAGATCAGGTCCATCGCAAGCGTACCCCCAGCGCGCATACCGCAACCCGCTC
GACCAGCTTGTCTGCTTCTTGGACGCCAAGCACGGCGACGGGTGGGCGATATGGGAGTTTAGGGCCGAGGGGACG
GGGTATCCGGACGAGGCGGTGTATGGACGCGTGAGGCACTATCCGTGGCCAGATCATCATCCGCCGCCGTTTAGG
TTGATGCCCTTGATTTTGGCGGGCATGAGGAATTGGCTTAAGGGGGGGCCGTTGGAGGAGGAGGCCAAGAAGGAG
GAGGACGAGGACAAGAAGGGGGAGGAGGACAAGAAGCGCGTCGTGGTGGTGCACTGCAAGGCTGGCAAGGGCCGC
AGCGGCACCGTGGCATGCAGCTACCTCATTGCCGAAGAGGGATGGAAGGCCGACGACGCCCTGGCCCGCTTCACG
CAGCGGCGCATGCGGCCTCGCTTTGGCGCAGGCGTGTCGATTCCGTCGCAGCTGCGGTGGGTGAGCTACATTGAC
CGCTGGGCCAAGCTTGGACGCAAACACTATGTCGACCGGCCCGTCGAGGTGCTCGAGATTCACGTCTGGGGCCTG
CGCCACGGCGTCAAGGTGAGCGTCGAGGGCTTCATTGACAATGGCCGCAACATTTATACCTACCACACCTTTTCC
AAGCCAGAGCGCATAGTCGTCGAGGCGGCGCCCCCCACGGGCTGGGGGTTTGCAGACTTGGTGTGGGAGCTGGCG
GGATACCCAGGCGACTCGACGAGCATGACGCGCCCCGACGACGACGATGCCAACAAACCTAATCGTAGGAGCCGG
CGCGCCAGCCTAATAGGCCACGACGCCGCCTCGTCTACCAAGCCAAAGCCCAGCAGCTCCTCCAGCTCCACATCC
TCATCATCATCCTCCTCCCGCACCGACAAGACGCGTCGCAAAACGCCTCCCGACCAAGAAGCAGAGCCGGGCGGC
ATGGCCGTCATTCTCCGGCCCCACACCCCCATCCTCATCCCCCACAGCGACATCAACATTGCCACGGAGCGCCGC
AGCCGCACCAACCCCAACGTCGGCCTCACCATGGTGTCCGCCGTGGCGCACGTCTGGTTCAATGCCTACTTTGAA
GGCGCCGGGCCAGAGGAGTGCGCTGCCGGCCGCCCCGCTGCAACAAGCGGCGTCTTTTCCATCTCGTGGGACGAC
ATGGACGGCATCAAGGGCTCTAGCCGCAAGGGGGCGCGCGCGCTGGATCGGCTGGCGGTGGTGTGGCGCGTGGCT
GAGGGGGCGCGTGGCGATGAGGTGCCGGAGCCGGAGACGGGGGGTGCGGTGAGGCAGTTTGAGGCGGCGGATTGG
ACGGGTGGGAGGGGGGAGGGCAAGGAGCAGAGAGGAGGAGAGGAGGAGGAGGAGGAGGAGATGGAGGGAGTGCGG
TGTAGTGGGCCGGCGGGCGAGGAGCCGCTCGAGCAAGAGGGTGCAAAGCAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail