Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5603
Gene name
LocationContig_449:790..2435
Strand-
Gene length (bp)1645
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4944
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|99
Ophiocordyceps australis map64 (Brazil) OphauB2|5603 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00926
Ophiocordyceps kimflemingae Ophio5|4568
Ophiocordyceps subramaniannii Hirsu2|1857

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5603
MARFDQAYAMMATLASIAGAGAPVGMTPPPTVTPAQVTLPSYSAEDEFGALGHANGLRQPNADPSLESFARVEFA
DSVFQMTTYAVIIGRDQGALMQARRDERQAEEHRRRTQENALQGLPPPSPIHRERSKFSKSYVSEEGGMLGPESD
SEDTGNARPSKRRKPSTTGSSQNDKDEALDKMIFNRQYVSHTPGAAAVDLRSLRPSPWHVPFIGIHSPGPNIASK
TKAISREHLKIVYNQAQGVFEAIPLHKNGFFCQDVHYNTDKVVLKCGDRLQIKDIDFRFIINGVERGCTGAEELE
EDDGAAANKAHTHGGKEMSFEFEGSHGNGAIQDTSDELSELEASPPELSDFEGLANGNDEDEDEEMDDAVEQKAK
TGAEAGGKEHGQAVLEQAQRMPAGLPDAPMPYQARKRGPGRPPKNGFMSKREQRLLKKAQLEMEKMKVPQTPAEQ
PVKRKVGRPRKHPLPDQGGERPEKRRYKPRKPKGEEGAQGASDGERRAKDKKDRRARPKSPALDLKIEDYSEEQL
QKPNKNYGTA*
Coding >OphauB2|5603
ATGGCTCGATTTGACCAGGCCTACGCCATGATGGCCACGCTGGCCTCGATTGCAGGGGCAGGAGCCCCAGTTGGC
ATGACGCCTCCCCCAACCGTGACGCCTGCGCAGGTGACGCTGCCGTCATACTCGGCCGAAGACGAGTTTGGCGCC
CTGGGCCACGCCAACGGCCTTCGCCAGCCCAATGCCGACCCTTCGCTCGAGTCGTTTGCCCGCGTCGAGTTTGCC
GACAGCGTCTTCCAAATGACTACCTATGCCGTCATCATTGGCCGTGATCAAGGCGCTCTTATGCAGGCGCGTCGC
GACGAGAGACAGGCCGAGGAGCACAGACGGCGGACCCAGGAGAATGCGCTGCAGGGCCTGCCCCCTCCGTCACCC
ATTCACCGCGAGCGTAGTAAATTTAGTAAATCCTACGTGAGCGAAGAAGGCGGCATGCTGGGCCCAGAGTCTGAT
AGTGAGGACACTGGCAACGCGCGGCCGTCTAAGCGCCGCAAGCCAAGCACCACGGGCTCGTCGCAAAACGACAAG
GACGAGGCGCTGGACAAGATGATTTTTAACCGGCAGTACGTGTCGCACACGCCGGGCGCGGCTGCTGTCGACTTG
CGCTCGTTGCGGCCGTCGCCCTGGCATGTCCCCTTTATCGGCATCCACTCCCCCGGGCCCAATATTGCCAGCAAG
ACCAAGGCCATTTCGCGGGAGCATCTCAAGATTGTCTATAACCAGGCCCAAGGGGTCTTTGAGGCGATTCCCTTG
CACAAGAATGGCTTCTTTTGCCAAGACGTGCACTACAATACCGACAAGGTGGTTCTCAAGTGCGGCGACCGCCTC
CAAATCAAGGATATTGATTTTCGGTTTATTATTAATGGCGTCGAGAGGGGGTGCACGGGCGCCGAAGAGCTTGAA
GAGGATGATGGCGCCGCCGCCAACAAGGCTCACACGCATGGCGGCAAGGAAATGAGTTTTGAGTTTGAGGGGTCG
CATGGCAACGGAGCCATTCAGGACACAAGTGATGAACTGTCTGAACTGGAAGCCAGCCCCCCCGAGCTGTCTGAT
TTTGAGGGGCTTGCCAATGGCAATGACGAGGATGAGGATGAAGAAATGGACGACGCTGTCGAGCAAAAGGCCAAG
ACGGGCGCCGAGGCTGGGGGCAAGGAGCATGGCCAGGCAGTGCTGGAGCAGGCGCAGCGTATGCCTGCAGGATTG
CCGGATGCACCAATGCCATACCAGGCGAGGAAGAGGGGCCCAGGCCGGCCGCCCAAGAATGGCTTCATGTCCAAG
AGGGAGCAGCGTTTGCTTAAAAAGGCACAGCTTGAGATGGAAAAGATGAAGGTGCCGCAGACGCCGGCCGAGCAG
CCCGTCAAGCGCAAGGTTGGCAGGCCGAGGAAGCATCCGCTGCCCGACCAAGGCGGCGAGCGGCCCGAGAAGCGC
AGATATAAGCCGCGCAAGCCCAAGGGCGAAGAGGGCGCCCAAGGGGCATCGGATGGAGAGCGGCGCGCCAAGGAC
AAGAAGGACAGGCGAGCGCGCCCCAAGTCGCCGGCGCTGGACCTCAAGATTGAAGACTATAGCGAGGAGCAGCTG
CAAAAGCCCAACAAGAATTACGGGACGGCTTGA
Transcript >OphauB2|5603
ATGGCTCGATTTGACCAGGCCTACGCCATGATGGCCACGCTGGCCTCGATTGCAGGGGCAGGAGCCCCAGTTGGC
ATGACGCCTCCCCCAACCGTGACGCCTGCGCAGGTGACGCTGCCGTCATACTCGGCCGAAGACGAGTTTGGCGCC
CTGGGCCACGCCAACGGCCTTCGCCAGCCCAATGCCGACCCTTCGCTCGAGTCGTTTGCCCGCGTCGAGTTTGCC
GACAGCGTCTTCCAAATGACTACCTATGCCGTCATCATTGGCCGTGATCAAGGCGCTCTTATGCAGGCGCGTCGC
GACGAGAGACAGGCCGAGGAGCACAGACGGCGGACCCAGGAGAATGCGCTGCAGGGCCTGCCCCCTCCGTCACCC
ATTCACCGCGAGCGTAGTAAATTTAGTAAATCCTACGTGAGCGAAGAAGGCGGCATGCTGGGCCCAGAGTCTGAT
AGTGAGGACACTGGCAACGCGCGGCCGTCTAAGCGCCGCAAGCCAAGCACCACGGGCTCGTCGCAAAACGACAAG
GACGAGGCGCTGGACAAGATGATTTTTAACCGGCAGTACGTGTCGCACACGCCGGGCGCGGCTGCTGTCGACTTG
CGCTCGTTGCGGCCGTCGCCCTGGCATGTCCCCTTTATCGGCATCCACTCCCCCGGGCCCAATATTGCCAGCAAG
ACCAAGGCCATTTCGCGGGAGCATCTCAAGATTGTCTATAACCAGGCCCAAGGGGTCTTTGAGGCGATTCCCTTG
CACAAGAATGGCTTCTTTTGCCAAGACGTGCACTACAATACCGACAAGGTGGTTCTCAAGTGCGGCGACCGCCTC
CAAATCAAGGATATTGATTTTCGGTTTATTATTAATGGCGTCGAGAGGGGGTGCACGGGCGCCGAAGAGCTTGAA
GAGGATGATGGCGCCGCCGCCAACAAGGCTCACACGCATGGCGGCAAGGAAATGAGTTTTGAGTTTGAGGGGTCG
CATGGCAACGGAGCCATTCAGGACACAAGTGATGAACTGTCTGAACTGGAAGCCAGCCCCCCCGAGCTGTCTGAT
TTTGAGGGGCTTGCCAATGGCAATGACGAGGATGAGGATGAAGAAATGGACGACGCTGTCGAGCAAAAGGCCAAG
ACGGGCGCCGAGGCTGGGGGCAAGGAGCATGGCCAGGCAGTGCTGGAGCAGGCGCAGCGTATGCCTGCAGGATTG
CCGGATGCACCAATGCCATACCAGGCGAGGAAGAGGGGCCCAGGCCGGCCGCCCAAGAATGGCTTCATGTCCAAG
AGGGAGCAGCGTTTGCTTAAAAAGGCACAGCTTGAGATGGAAAAGATGAAGGTGCCGCAGACGCCGGCCGAGCAG
CCCGTCAAGCGCAAGGTTGGCAGGCCGAGGAAGCATCCGCTGCCCGACCAAGGCGGCGAGCGGCCCGAGAAGCGC
AGATATAAGCCGCGCAAGCCCAAGGGCGAAGAGGGCGCCCAAGGGGCATCGGATGGAGAGCGGCGCGCCAAGGAC
AAGAAGGACAGGCGAGCGCGCCCCAAGTCGCCGGCGCTGGACCTCAAGATTGAAGACTATAGCGAGGAGCAGCTG
CAAAAGCCCAACAAGAATTACGGGACGGCTTGA
Gene >OphauB2|5603
ATGGCTCGATTTGACCAGGCCTACGCCATGATGGCCACGCTGGCCTCGATTGCAGGGGCAGGAGCCCCAGTTGGC
ATGACGCCTCCCCCAACCGTGACGCCTGCGCAGGTGACGCTGCCGTCATACTCGGCCGAAGACGAGTTTGGCGCC
CTGGGCCACGCCAACGGCCTTCGCCAGCCCAATGCCGACCCTTCGCTCGAGTCGTTTGCCCGCGTCGAGTTTGCC
GACAGCGTCTTCCAAATGACTACCTATGCCGTCATCATTGGCCGTGATCAAGGCGCTCTTATGCAGGCGCGTCGC
GACGAGAGACAGGCCGAGGAGCACAGACGGCGGACCCAGGAGAATGCGCTGCAGGGCCTGCCCCCTCCGTCACCC
ATTCACCGCGAGCGTAGTAAATTTAGTAAATCCTACGTGAGCGAAGAAGGCGGCATGCTGGGCCCAGAGTCTGAT
AGTGAGGACACTGGCAACGCGCGGCCGTCTAAGCGCCGCAAGCCAAGCACCACGGGCTCGTCGCAAAACGACAAG
GACGAGGCGCTGGACAAGATGATTTTTAACCGGCAGTACGTGTCGCACACGCCGGGCGCGGCTGCTGTCGACTTG
CGCTCGTTGCGGCCGTCGCCCTGGCATGTCCCCTTTATCGGCATCCACTCCCCCGGGCCCAATATTGCCAGCAAG
ACCAAGGCCATTTCGCGGGAGCATCTCAAGATTGTCTATAACCAGGCCCAAGGGGTCTTTGAGGCGATTCCCTTG
CACAAGAATGGCTTCTTTTGCCAAGACGTGCACTACAATACCGACAAGGTGGTTCTCAAGTGCGGCGACCGCCTC
CAAATCAAGGATATTGATTTTCGGTTTATTATTAATGGCGTCGAGAGGGGGTGCACGGGCGCCGAAGAGCTTGAA
GAGGATGATGGCGCCGCCGCCAACAAGGCTCACACGCATGGCGGCAAGGAAATGAGTTTTGAGTTTGAGGGGTCG
CATGGCAACGGAGCCATTCAGGACACAAGTGATGAACTGTCTGAACTGGAAGCCAGCCCCCCCGAGCTGTCTGAT
TTTGAGGGGCTTGCCAATGGCAATGACGAGGATGAGGATGAAGAAATGGACGACGCTGTCGAGCAAAAGGCCAAG
ACGGGCGCCGAGGCTGGGGGCAAGGAGCATGGCCAGGCAGTGCTGGAGCAGGCGCAGCGTATGCCTGCAGGATTG
CCGGATGCACCAATGCCATACCAGGCGAGGAAGAGGGGCCCAGGCCGGCCGCCCAAGAATGGCTTCATGTCCAAG
AGGGAGCAGCGTTTGCTTAAAAAGGCACAGCTTGAGATGGAAAAGATGAAGGTGCCGCAGACGCCGGCCGAGCAG
CCCGTCAAGCGCAAGGTTGGCAGGCCGAGGAAGCATCCGCTGCCCGACCAAGGCGGCGAGCGGCCCGAGAAGCGC
AGATATAAGCCGCGCAAGCCCAAGGGCGAAGAGGGCGCCCAAGGGGCATCGGATGGAGAGCGGCGCGCCAAGGAC
AAGAAGGACAGGCGAGCGCGCCCCAAGTCGCCGGCGCTGGACCTCAAGATTGAAGACTATAGCGAGGAGCAGCTG
CAAAAGCCCAACAAGAATTACGGGGTGCTTATAGACGAGACGCTCACGGCGGCCGGGCCAGACGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail