Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5602
Gene name
LocationContig_446:1499..2093
Strand-
Gene length (bp)594
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.3E-12 103 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74968|RU1A_SCHPO U1 small nuclear ribonucleoprotein usp102 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp102 PE=1 SV=1 1 174 2.0E-30
sp|Q9CQI7|RU2B_MOUSE U2 small nuclear ribonucleoprotein B'' OS=Mus musculus GN=Snrpb2 PE=1 SV=1 1 174 1.0E-20
sp|P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens GN=SNRPB2 PE=1 SV=1 1 174 3.0E-20
sp|Q0DKM4|RU1A_ORYSJ U1 small nuclear ribonucleoprotein A OS=Oryza sativa subsp. japonica GN=Os05g0154800 PE=3 SV=1 1 174 1.0E-18
sp|A2Y0J7|RU1A_ORYSI U1 small nuclear ribonucleoprotein A OS=Oryza sativa subsp. indica GN=OsI_18512 PE=3 SV=1 1 174 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74968|RU1A_SCHPO U1 small nuclear ribonucleoprotein usp102 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp102 PE=1 SV=1 1 174 2.0E-30
sp|Q9CQI7|RU2B_MOUSE U2 small nuclear ribonucleoprotein B'' OS=Mus musculus GN=Snrpb2 PE=1 SV=1 1 174 1.0E-20
sp|P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens GN=SNRPB2 PE=1 SV=1 1 174 3.0E-20
sp|Q0DKM4|RU1A_ORYSJ U1 small nuclear ribonucleoprotein A OS=Oryza sativa subsp. japonica GN=Os05g0154800 PE=3 SV=1 1 174 1.0E-18
sp|A2Y0J7|RU1A_ORYSI U1 small nuclear ribonucleoprotein A OS=Oryza sativa subsp. indica GN=OsI_18512 PE=3 SV=1 1 174 1.0E-18
sp|Q62189|SNRPA_MOUSE U1 small nuclear ribonucleoprotein A OS=Mus musculus GN=Snrpa PE=1 SV=3 1 174 2.0E-17
sp|O22922|RU2B1_ARATH U2 small nuclear ribonucleoprotein B'' OS=Arabidopsis thaliana GN=U2B'' PE=1 SV=1 1 159 4.0E-17
sp|P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens GN=SNRPA PE=1 SV=3 1 174 4.0E-17
sp|Q2KIR1|SNRPA_BOVIN U1 small nuclear ribonucleoprotein A OS=Bos taurus GN=SNRPA PE=2 SV=1 1 174 8.0E-17
sp|Q54J05|RU2B_DICDI U2 small nuclear ribonucleoprotein B'' OS=Dictyostelium discoideum GN=snrpb2 PE=3 SV=1 1 147 9.0E-17
sp|Q06AA4|SNRPA_PIG U1 small nuclear ribonucleoprotein A OS=Sus scrofa GN=SNRPA PE=1 SV=1 1 174 2.0E-16
sp|B8AM21|RU2B_ORYSI U2 small nuclear ribonucleoprotein B'' OS=Oryza sativa subsp. indica GN=OsI_11177 PE=3 SV=1 1 159 4.0E-16
sp|P45429|SNRPA_XENLA U1 small nuclear ribonucleoprotein A OS=Xenopus laevis GN=snrpa PE=2 SV=1 1 174 4.0E-16
sp|Q10MR0|RU2B_ORYSJ U2 small nuclear ribonucleoprotein B'' OS=Oryza sativa subsp. japonica GN=Os03g0298800 PE=2 SV=1 1 159 5.0E-16
sp|Q39244|RU1A_ARATH U1 small nuclear ribonucleoprotein A OS=Arabidopsis thaliana GN=U1A PE=1 SV=1 1 174 6.0E-16
sp|P43332|SNRPA_DROME U1 small nuclear ribonucleoprotein A OS=Drosophila melanogaster GN=snf PE=1 SV=1 98 174 2.0E-15
sp|Q8H1S6|RU2B2_ARATH U2 small nuclear ribonucleoprotein B'' 2 OS=Arabidopsis thaliana GN=At1g06960 PE=1 SV=1 1 159 3.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5602
MQDFNLFGKPMRLAIAHAPSDKTIELRGSSNDLEQYKKQRRHDKEKRKAAEPTQDQKQLKLKRGAGAGSDTRPSK
LLKPSAPRPGGASTSVIPDEYLPPNKVLFVQNVPDDYDAPALTAVFGQFEGFREIRLVPGRRGIAFVEYQSEQGA
ISAKKAIAGTILSDKAIKVTYQRQ*
Coding >OphauB2|5602
ATGCAGGACTTTAATCTCTTCGGAAAACCAATGCGTCTTGCCATAGCTCATGCGCCAAGCGATAAGACGATCGAA
TTAAGGGGCTCGAGTAATGATCTCGAGCAGTACAAGAAGCAACGCAGACATGACAAGGAAAAACGCAAGGCTGCT
GAACCCACACAAGATCAGAAACAACTCAAGCTTAAAAGAGGTGCCGGGGCGGGCTCGGATACCAGACCCTCAAAG
TTGCTCAAGCCGTCAGCTCCGAGACCTGGGGGTGCATCGACCTCGGTTATCCCTGACGAGTATTTGCCACCAAAC
AAGGTTCTATTCGTACAGAACGTGCCTGATGACTACGATGCTCCCGCGCTCACAGCAGTCTTTGGTCAATTCGAA
GGATTCAGGGAAATCAGGTTAGTGCCAGGACGACGAGGCATTGCATTTGTCGAGTATCAGTCCGAACAAGGAGCC
ATTTCCGCGAAAAAGGCCATTGCTGGCACGATACTTAGCGATAAAGCCATTAAAGTCACGTACCAACGCCAATAG
Transcript >OphauB2|5602
ATGCAGGACTTTAATCTCTTCGGAAAACCAATGCGTCTTGCCATAGCTCATGCGCCAAGCGATAAGACGATCGAA
TTAAGGGGCTCGAGTAATGATCTCGAGCAGTACAAGAAGCAACGCAGACATGACAAGGAAAAACGCAAGGCTGCT
GAACCCACACAAGATCAGAAACAACTCAAGCTTAAAAGAGGTGCCGGGGCGGGCTCGGATACCAGACCCTCAAAG
TTGCTCAAGCCGTCAGCTCCGAGACCTGGGGGTGCATCGACCTCGGTTATCCCTGACGAGTATTTGCCACCAAAC
AAGGTTCTATTCGTACAGAACGTGCCTGATGACTACGATGCTCCCGCGCTCACAGCAGTCTTTGGTCAATTCGAA
GGATTCAGGGAAATCAGGTTAGTGCCAGGACGACGAGGCATTGCATTTGTCGAGTATCAGTCCGAACAAGGAGCC
ATTTCCGCGAAAAAGGCCATTGCTGGCACGATACTTAGCGATAAAGCCATTAAAGTCACGTACCAACGCCAATAG
Gene >OphauB2|5602
ATGCAGGACTTTAATCTCTTCGGAAAACCAATGCGTCTTGCCATAGCTCATGCGCCAAGCGATAAGACGATCGAA
TTAAGGGGCTCGAGTAATGATCTCGAGCAGTACAAGAAGCAACGCAGACATGACAAGGGTGTGTACATACTCGTG
CTATAGATGGAGCAGTTAAACACATAGGCAGGCTAACTTGGCTGCCCGTTAGAAAAACGCAAGGCTGCTGAACCC
ACACAAGATCAGAAACAACTCAAGCTTAAAAGAGGTGCCGGGGCGGGCTCGGATACCAGACCCTCAAAGTTGCTC
AAGCCGTCAGCTCCGAGACCTGGGGGTGCATCGACCTCGGTTATCCCTGACGAGTATTTGCCACCAAACAAGGTT
CTATTCGTACAGAACGTGCCTGATGACTACGATGCTCCCGCGCTCACAGCAGTCTTTGGTCAATTCGAAGGATTC
AGGGAAATCAGGTTAGTGCCAGGACGACGAGGCATTGCATTTGTCGAGTATCAGTCCGAACAAGGAGCCATTTCC
GCGAAAAAGGCCATTGCTGGCACGATACTTAGCGATAAAGCCATTAAAGTCACGTACCAACGCCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail