Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5599
Gene name
LocationContig_443:1317..2412
Strand-
Gene length (bp)1095
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07534 TLD TLD 1.2E-24 170 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8S2|OXR1_GIBZE Oxidation resistance protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=OXR1 PE=3 SV=1 64 345 5.0E-128
sp|Q7S4P1|OXR1_NEUCR Oxidation resistance protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=oxr1 PE=3 SV=2 68 345 4.0E-94
sp|Q874Z5|OXR1_PODAS Oxidation resistance protein 1 OS=Podospora anserina GN=OXR1 PE=3 SV=1 59 345 2.0E-87
sp|Q6FSN5|OXR1_CANGA Oxidation resistance protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=OXR1 PE=3 SV=1 129 344 6.0E-46
sp|Q4WX99|OXR1_ASPFU Oxidation resistance protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=oxr1 PE=3 SV=1 73 298 2.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8S2|OXR1_GIBZE Oxidation resistance protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=OXR1 PE=3 SV=1 64 345 5.0E-128
sp|Q7S4P1|OXR1_NEUCR Oxidation resistance protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=oxr1 PE=3 SV=2 68 345 4.0E-94
sp|Q874Z5|OXR1_PODAS Oxidation resistance protein 1 OS=Podospora anserina GN=OXR1 PE=3 SV=1 59 345 2.0E-87
sp|Q6FSN5|OXR1_CANGA Oxidation resistance protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=OXR1 PE=3 SV=1 129 344 6.0E-46
sp|Q4WX99|OXR1_ASPFU Oxidation resistance protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=oxr1 PE=3 SV=1 73 298 2.0E-45
sp|Q08952|OXR1_YEAST Oxidation resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXR1 PE=1 SV=1 90 344 8.0E-45
sp|Q5B8X6|OXR1_EMENI Oxidation resistance protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=oxr1 PE=3 SV=1 114 304 2.0E-44
sp|Q6CMK8|OXR1_KLULA Oxidation resistance protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=OXR1 PE=3 SV=1 143 344 2.0E-44
sp|Q6C443|OXR1_YARLI Oxidation resistance protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=OXR1 PE=3 SV=1 144 344 2.0E-44
sp|Q755A3|OXR1_ASHGO Oxidation resistance protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=OXR1 PE=3 SV=2 143 344 3.0E-40
sp|Q6BJM5|OXR1_DEBHA Oxidation resistance protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=OXR1 PE=3 SV=2 128 345 5.0E-40
sp|Q5AEM5|OXR1_CANAL Oxidation resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OXR1 PE=3 SV=1 128 345 1.0E-35
sp|O14284|OXR1_SCHPO Oxidation resistance protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxr1 PE=1 SV=1 143 343 1.0E-27
sp|Q6ZZF5|OXR1_CYBJA Oxidation resistance protein 1 (Fragment) OS=Cyberlindnera jadinii GN=OXR1 PE=3 SV=1 125 292 2.0E-26
sp|P0CP42|OXR1_CRYNJ Oxidation resistance protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=OXR1 PE=3 SV=1 60 341 2.0E-19
sp|P0CP43|OXR1_CRYNB Oxidation resistance protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=OXR1 PE=3 SV=1 60 341 2.0E-19
sp|A0PJX2|TLDC2_HUMAN TLD domain-containing protein 2 OS=Homo sapiens GN=TLDC2 PE=2 SV=1 144 343 1.0E-16
sp|A2ACG1|TLDC2_MOUSE TLD domain-containing protein 2 OS=Mus musculus GN=Tldc2 PE=3 SV=1 144 343 8.0E-14
sp|Q0IID2|TLDC2_BOVIN TLD domain-containing protein 2 OS=Bos taurus GN=TLDC2 PE=2 SV=1 141 343 8.0E-14
sp|A8KBE0|OXR1_XENTR Oxidation resistance protein 1 OS=Xenopus tropicalis GN=oxr1 PE=2 SV=2 145 343 4.0E-12
sp|Q6DFV7|NCOA7_MOUSE Nuclear receptor coactivator 7 OS=Mus musculus GN=Ncoa7 PE=1 SV=2 145 343 5.0E-12
sp|Q5ZMS4|NCOA7_CHICK Nuclear receptor coactivator 7 OS=Gallus gallus GN=NCOA7 PE=2 SV=1 145 343 6.0E-12
sp|Q8NI08|NCOA7_HUMAN Nuclear receptor coactivator 7 OS=Homo sapiens GN=NCOA7 PE=1 SV=2 145 343 1.0E-11
sp|Q4V8B0|OXR1_RAT Oxidation resistance protein 1 OS=Rattus norvegicus GN=Oxr1 PE=1 SV=3 120 343 1.0E-11
sp|A5PKL1|OXR1_BOVIN Oxidation resistance protein 1 OS=Bos taurus GN=OXR1 PE=2 SV=2 168 343 1.0E-11
sp|Q4KMM3|OXR1_MOUSE Oxidation resistance protein 1 OS=Mus musculus GN=Oxr1 PE=1 SV=3 145 343 3.0E-11
sp|B4F6Q9|OXR1_XENLA Oxidation resistance protein 1 OS=Xenopus laevis GN=oxr1 PE=2 SV=2 145 343 3.0E-11
sp|Q8N573|OXR1_HUMAN Oxidation resistance protein 1 OS=Homo sapiens GN=OXR1 PE=1 SV=2 145 343 3.0E-11
sp|Q9ULP9|TBC24_HUMAN TBC1 domain family member 24 OS=Homo sapiens GN=TBC1D24 PE=1 SV=2 145 341 1.0E-10
sp|Q6DDZ9|TLDC1_XENLA TLD domain-containing protein 1 OS=Xenopus laevis GN=tldc1 PE=2 SV=1 164 344 3.0E-09
sp|Q3UUG6|TBC24_MOUSE TBC1 domain family member 24 OS=Mus musculus GN=Tbc1d24 PE=1 SV=2 145 341 3.0E-08
sp|A1A5K6|TBC24_XENLA TBC1 domain family member 24 OS=Xenopus laevis GN=tbc1d24 PE=2 SV=1 145 341 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5599
MEPITGAGGGSNASCSSRCSDGSTVAPPSLSRCSGLADTAKVITDGGQDAQASFPLAPSETWPASSYLGSMWTGL
MRRFSSEDGAGGHDDGSPQQLPHHHDYAQQPTSDGINGVFTPVGRRASPFRPPSLEPVVLHGPRHGFDRLLTAAM
AEEIRAMVPERLRIAEDWRLVYSLEEDGASLATLYQKCKHFESCRVGFVLVVQDYDAGTFGAYLSEHPHPCHNYF
GNGECFLWRASTMASLPPPPSANTTHLTRCTTLAPSSIESATGESIRFKAFPYSGLNDCYMNCETHFLSVGSGGG
HYGLWLDDSLNIGHSSRCDTFGNEPLSDAGEKFSVLGVELWVLGA*
Coding >OphauB2|5599
ATGGAACCCATTACTGGCGCTGGTGGAGGCTCCAACGCTTCTTGTAGCTCCCGGTGCTCCGATGGCTCTACCGTG
GCGCCACCCTCACTCTCGCGCTGCTCCGGACTAGCAGACACTGCCAAGGTGATTACCGATGGGGGGCAAGATGCC
CAGGCGAGTTTTCCTTTAGCACCGTCGGAAACGTGGCCGGCTTCGTCGTATTTGGGAAGCATGTGGACAGGACTC
ATGCGGCGCTTCTCATCCGAGGATGGGGCTGGCGGCCATGATGACGGCTCGCCCCAGCAGCTCCCACATCATCAT
GATTACGCCCAACAACCAACCAGTGATGGCATTAACGGCGTCTTTACCCCTGTTGGGCGACGTGCCAGTCCATTC
AGACCGCCATCGCTCGAGCCTGTTGTTCTGCATGGGCCGCGTCATGGCTTCGACCGCCTCTTGACAGCGGCAATG
GCCGAGGAGATTCGTGCCATGGTGCCTGAACGACTGCGCATCGCCGAGGACTGGCGCCTGGTATATAGCCTCGAA
GAGGACGGGGCTAGCCTTGCCACGCTCTACCAGAAATGCAAACACTTCGAATCATGTAGAGTCGGCTTTGTTCTA
GTTGTCCAGGATTACGACGCTGGGACTTTTGGAGCCTACTTATCCGAACACCCGCACCCCTGTCACAACTACTTT
GGCAACGGCGAGTGTTTCCTGTGGCGTGCCTCGACCATGGCCTCGCTTCCACCACCCCCTTCGGCCAATACCACG
CACCTGACGCGCTGCACCACTTTGGCACCCTCGTCTATCGAAAGCGCTACGGGCGAGTCAATTCGCTTTAAAGCT
TTCCCCTATAGTGGGCTCAATGACTGTTACATGAATTGCGAGACTCATTTTCTCAGCGTCGGCTCCGGAGGTGGG
CATTACGGACTTTGGCTCGATGACTCACTCAATATTGGGCACAGCTCCCGGTGCGATACTTTTGGCAATGAGCCA
CTGAGTGACGCTGGTGAAAAGTTTAGCGTCTTGGGGGTTGAACTATGGGTGCTTGGAGCCTAA
Transcript >OphauB2|5599
ATGGAACCCATTACTGGCGCTGGTGGAGGCTCCAACGCTTCTTGTAGCTCCCGGTGCTCCGATGGCTCTACCGTG
GCGCCACCCTCACTCTCGCGCTGCTCCGGACTAGCAGACACTGCCAAGGTGATTACCGATGGGGGGCAAGATGCC
CAGGCGAGTTTTCCTTTAGCACCGTCGGAAACGTGGCCGGCTTCGTCGTATTTGGGAAGCATGTGGACAGGACTC
ATGCGGCGCTTCTCATCCGAGGATGGGGCTGGCGGCCATGATGACGGCTCGCCCCAGCAGCTCCCACATCATCAT
GATTACGCCCAACAACCAACCAGTGATGGCATTAACGGCGTCTTTACCCCTGTTGGGCGACGTGCCAGTCCATTC
AGACCGCCATCGCTCGAGCCTGTTGTTCTGCATGGGCCGCGTCATGGCTTCGACCGCCTCTTGACAGCGGCAATG
GCCGAGGAGATTCGTGCCATGGTGCCTGAACGACTGCGCATCGCCGAGGACTGGCGCCTGGTATATAGCCTCGAA
GAGGACGGGGCTAGCCTTGCCACGCTCTACCAGAAATGCAAACACTTCGAATCATGTAGAGTCGGCTTTGTTCTA
GTTGTCCAGGATTACGACGCTGGGACTTTTGGAGCCTACTTATCCGAACACCCGCACCCCTGTCACAACTACTTT
GGCAACGGCGAGTGTTTCCTGTGGCGTGCCTCGACCATGGCCTCGCTTCCACCACCCCCTTCGGCCAATACCACG
CACCTGACGCGCTGCACCACTTTGGCACCCTCGTCTATCGAAAGCGCTACGGGCGAGTCAATTCGCTTTAAAGCT
TTCCCCTATAGTGGGCTCAATGACTGTTACATGAATTGCGAGACTCATTTTCTCAGCGTCGGCTCCGGAGGTGGG
CATTACGGACTTTGGCTCGATGACTCACTCAATATTGGGCACAGCTCCCGGTGCGATACTTTTGGCAATGAGCCA
CTGAGTGACGCTGGTGAAAAGTTTAGCGTCTTGGGGGTTGAACTATGGGTGCTTGGAGCCTAA
Gene >OphauB2|5599
ATGGAACCCATTACTGGCGCTGGTGGAGGCTCCAACGCTTCTTGTAGCTCCCGGTGCTCCGATGGCTCTACCGTG
GCGCCACCCTCACTCTCGCGCTGCTCCGGACTAGCAGACACTGCCAAGGTGATTACCGATGGGGGGCAAGATGCC
CAGGCGAGTTTTCCTTTAGCACCGTCGGAAACGTGGCCGGCTTCGTCGTATTTGGGAAGCATGTGGACAGGACTC
ATGCGGCGCTTCTCATCCGAGGATGGGGCTGGCGGCCATGATGACGGCTCGCCCCAGCAGCTCCCACATCATCAT
GATTACGCCCAACAACCAACCAGTGATGGCATTAACGGCGTCTTTACCCCTGTTGGGCGACGTGCCAGTCCATTC
AGACCGCCATCGCTCGAGCCTGTTGTTCTGCATGGGCCGCGTCATGGCTTCGACCGCCTCTTGACAGCGGCAATG
GCCGAGGAGATTCGTGCCATGGTGCCTGAACGACTGCGCATCGCCGAGGACTGGCGCCTGGTATATAGCCTCGAA
GAGGACGGGGCTAGCCTTGCCACGCTCTACCAGAAATGCAAACACTTCGAATCATGTAGAGTCGGCTTTGTTCTA
GTTGTCCAGGATTACGACGCTGGGGTGAGGCCAGCGGCTACTATTCCCTGCTCTGTCTTGTTTCACTGACAGACG
CGGCAGACTTTTGGAGCCTACTTATCCGAACACCCGCACCCCTGTCACAACTACTTTGGCAACGGCGAGTGTTTC
CTGTGGCGTGCCTCGACCATGGCCTCGCTTCCACCACCCCCTTCGGCCAATACCACGCACCTGACGCGCTGCACC
ACTTTGGCACCCTCGTCTATCGAAAGCGCTACGGGCGAGTCAATTCGCTTTAAAGCTTTCCCCTATAGTGGGCTC
AATGACTGTTACATGAATTGCGAGACTCATTTTCTCAGCGTCGGCTCCGGAGGTGGGCATTACGGACTTTGGCTC
GATGACTCACTCAATATTGGGCACAGCTCCCGGTGCGATACTTTTGGCAATGAGCCACTGAGTGACGCTGGTGAA
AAGTTTAGCGTCTTGGGGGTTGAACTATGGGTGCTTGGAGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail