Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5595
Gene name
LocationContig_44:130188..130881
Strand-
Gene length (bp)693
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 3.8E-11 41 90
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.7E-09 41 90
PF14634 zf-RING_5 zinc-RING finger domain 4.0E-07 42 90
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 5.6E-06 42 93
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.9E-04 42 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7K6|YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.04c PE=3 SV=1 40 154 7.0E-07
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 40 95 5.0E-06
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 41 93 5.0E-06
sp|Q8LGA5|ATL31_ARATH E3 ubiquitin-protein ligase ATL31 OS=Arabidopsis thaliana GN=ATL31 PE=1 SV=2 40 98 9.0E-06
sp|Q0II22|RN126_BOVIN E3 ubiquitin-protein ligase RNF126 OS=Bos taurus GN=RNF126 PE=2 SV=1 17 93 1.0E-05
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7K6|YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.04c PE=3 SV=1 40 154 7.0E-07
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 40 95 5.0E-06
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 41 93 5.0E-06
sp|Q8LGA5|ATL31_ARATH E3 ubiquitin-protein ligase ATL31 OS=Arabidopsis thaliana GN=ATL31 PE=1 SV=2 40 98 9.0E-06
sp|Q0II22|RN126_BOVIN E3 ubiquitin-protein ligase RNF126 OS=Bos taurus GN=RNF126 PE=2 SV=1 17 93 1.0E-05
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 17 104 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005680 anaphase-promoting complex Yes
GO:0008270 zinc ion binding Yes
GO:0097602 cullin family protein binding Yes
GO:0061630 ubiquitin protein ligase activity Yes
GO:0003674 molecular_function No
GO:1901565 organonitrogen compound catabolic process No
GO:1902494 catalytic complex No
GO:0140096 catalytic activity, acting on a protein No
GO:0019941 modification-dependent protein catabolic process No
GO:1990234 transferase complex No
GO:0140535 intracellular protein-containing complex No
GO:0000151 ubiquitin ligase complex No
GO:0043167 ion binding No
GO:0006508 proteolysis No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0030163 protein catabolic process No
GO:0046914 transition metal ion binding No
GO:1901575 organic substance catabolic process No
GO:0008152 metabolic process No
GO:0009056 catabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0019538 protein metabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0005515 protein binding No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0044248 cellular catabolic process No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0004842 ubiquitin-protein transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5595
MGDQAPHSQPRQRTVTPLSREEMASLLKEGQARLTLSDPLSCVICYNDFGVESPEGINEVPFRLPRCKHVFGDHC
IKRWFEDSDSCPYCRDKVRPEPKHYQTSSRAFMNFMRLRGAALPSALSAELYSRFLEITGNEGDLINALSRRDRI
NAAHDSAEAAEVRVDHTKQRPTRIDPSPLLNTRRCQCRTYMNIRFRK*
Coding >OphauB2|5595
ATGGGTGACCAGGCGCCTCACTCGCAGCCTCGACAACGCACCGTCACCCCGCTGTCGCGGGAGGAGATGGCCTCG
CTGCTGAAAGAGGGCCAAGCAAGACTGACGCTTTCTGACCCTTTATCCTGCGTCATTTGCTACAACGACTTTGGC
GTCGAGTCCCCCGAGGGAATCAACGAAGTTCCTTTTCGCCTACCTAGGTGCAAACACGTGTTTGGTGATCATTGC
ATCAAGAGATGGTTTGAGGATTCGGATAGCTGTCCATACTGCCGCGACAAGGTGCGCCCGGAGCCCAAACACTAC
CAAACCTCATCAAGGGCCTTTATGAACTTCATGAGACTGCGGGGTGCCGCTCTCCCTTCGGCGCTTTCGGCGGAG
CTCTACTCGCGGTTTTTGGAAATAACTGGCAATGAAGGCGACTTGATTAATGCTTTGTCACGACGTGACCGTATC
AACGCCGCACACGACAGCGCCGAAGCAGCCGAAGTCCGCGTAGACCACACCAAGCAGCGCCCCACGAGAATAGAT
CCGTCACCGCTCCTCAATACTCGACGTTGCCAATGCCGGACCTATATGAACATCCGCTTTCGGAAATGA
Transcript >OphauB2|5595
ATGGGTGACCAGGCGCCTCACTCGCAGCCTCGACAACGCACCGTCACCCCGCTGTCGCGGGAGGAGATGGCCTCG
CTGCTGAAAGAGGGCCAAGCAAGACTGACGCTTTCTGACCCTTTATCCTGCGTCATTTGCTACAACGACTTTGGC
GTCGAGTCCCCCGAGGGAATCAACGAAGTTCCTTTTCGCCTACCTAGGTGCAAACACGTGTTTGGTGATCATTGC
ATCAAGAGATGGTTTGAGGATTCGGATAGCTGTCCATACTGCCGCGACAAGGTGCGCCCGGAGCCCAAACACTAC
CAAACCTCATCAAGGGCCTTTATGAACTTCATGAGACTGCGGGGTGCCGCTCTCCCTTCGGCGCTTTCGGCGGAG
CTCTACTCGCGGTTTTTGGAAATAACTGGCAATGAAGGCGACTTGATTAATGCTTTGTCACGACGTGACCGTATC
AACGCCGCACACGACAGCGCCGAAGCAGCCGAAGTCCGCGTAGACCACACCAAGCAGCGCCCCACGAGAATAGAT
CCGTCACCGCTCCTCAATACTCGACGTTGCCAATGCCGGACCTATATGAACATCCGCTTTCGGAAATGA
Gene >OphauB2|5595
ATGGGTGACCAGGCGCCTCACTCGCAGCCTCGACAACGCACCGTCACCCCGCTGTCGCGGGAGGAGATGGCCTCG
CTGCTGAAAGAGGGCCAAGCAAGACTGACGCTTTCTGACCCTTTATCCTGCGTCATTTGCTACAACGACTTTGGC
GTCGAGTCCCCCGAGGGAATCAACGAAGTTCCTTTTCGCCTACCTAGGTGCAAACACGTGTTTGGTGATCATTGC
ATCAAGAGATGGTTTGAGGATTCGGATAGCTGTCCATACTGCCGCGACAAGGTGCGCCCGGAGCCCAAACACTAC
CAAACCTCATCAAGGGCCTTTATGAACTTCATGAGACTGCGGGGTGCCGCTCTCCCTTCGGCGTCGGTGCATCCT
TGCCCCAAGGCCCTATCAACAATGGCGCTGACTTTGGCGTCAGGCTTTCGGCGGAGCTCTACTCGCGGTTTTTGG
AAATAACTGGCAATGAAGGCGACTTGATTAATGCTTTGTCACGACGTGACCGTGTAGCAGACCGACGCTCTCCCC
CCGACGATGACACGGGATTAGATCAACGCCGCACACGACAGCGCCGAAGCAGCCGAAGTCCGCGTAGACCACACC
AAGCAGCGCCCCACGAGAATAGATCCGTCACCGCTCCTCAATACTCGACGTTGCCAATGCCGGACCTATATGAAC
ATCCGCTTTCGGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail