Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5581
Gene name
LocationContig_44:81754..82515
Strand-
Gene length (bp)761
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02996 Prefoldin Prefoldin subunit 5.4E-24 25 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94307|PFD5_SCHPO Probable prefoldin subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bob1 PE=1 SV=1 1 144 6.0E-27
sp|Q99471|PFD5_HUMAN Prefoldin subunit 5 OS=Homo sapiens GN=PFDN5 PE=1 SV=2 6 151 4.0E-23
sp|Q9WU28|PFD5_MOUSE Prefoldin subunit 5 OS=Mus musculus GN=Pfdn5 PE=1 SV=1 6 151 5.0E-23
sp|Q5RAY0|PFD5_PONAB Prefoldin subunit 5 OS=Pongo abelii GN=PFDN5 PE=2 SV=1 6 151 5.0E-23
sp|Q8HYI9|PFD5_BOVIN Prefoldin subunit 5 OS=Bos taurus GN=PFDN5 PE=2 SV=1 6 151 8.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94307|PFD5_SCHPO Probable prefoldin subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bob1 PE=1 SV=1 1 144 6.0E-27
sp|Q99471|PFD5_HUMAN Prefoldin subunit 5 OS=Homo sapiens GN=PFDN5 PE=1 SV=2 6 151 4.0E-23
sp|Q9WU28|PFD5_MOUSE Prefoldin subunit 5 OS=Mus musculus GN=Pfdn5 PE=1 SV=1 6 151 5.0E-23
sp|Q5RAY0|PFD5_PONAB Prefoldin subunit 5 OS=Pongo abelii GN=PFDN5 PE=2 SV=1 6 151 5.0E-23
sp|Q8HYI9|PFD5_BOVIN Prefoldin subunit 5 OS=Bos taurus GN=PFDN5 PE=2 SV=1 6 151 8.0E-23
sp|Q04493|PFD5_YEAST Prefoldin subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM5 PE=1 SV=1 6 143 5.0E-20
sp|Q9VCZ8|PFD5_DROME Probable prefoldin subunit 5 OS=Drosophila melanogaster GN=CG7048 PE=2 SV=1 2 153 3.0E-18
sp|Q54V55|PFD5_DICDI Probable prefoldin subunit 5 OS=Dictyostelium discoideum GN=pfdn5 PE=3 SV=1 4 145 4.0E-17
sp|P57742|PFD5_ARATH Probable prefoldin subunit 5 OS=Arabidopsis thaliana GN=At5g23290 PE=2 SV=1 3 132 6.0E-14
sp|Q21993|PFD5_CAEEL Probable prefoldin subunit 5 OS=Caenorhabditis elegans GN=pfd-5 PE=2 SV=1 1 151 4.0E-11
sp|A8XPL7|PFD5_CAEBR Probable prefoldin subunit 5 OS=Caenorhabditis briggsae GN=pfd-5 PE=3 SV=2 1 151 2.0E-10
sp|A1RXA9|PFDA_THEPD Prefoldin subunit alpha OS=Thermofilum pendens (strain Hrk 5) GN=pfdA PE=3 SV=1 18 117 3.0E-06
sp|Q2FS96|PFDA_METHJ Prefoldin subunit alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pfdA PE=3 SV=1 68 152 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5581
MPGERETIHLDSLEPPQLAQVKKQLDEELEHLTSSYAQLHSAQTRFRDCLRCCVAAHGDGTSALSDKVLVPLTNS
LYVHATLAAKDRVLVDIGTGFLIEKKLESAEKYYDSKVQDLTSNLKELEAIVQRKQSNVMAVEEVLRQKLMAAQA
SQS*
Coding >OphauB2|5581
ATGCCCGGCGAGCGCGAAACCATTCACCTCGACAGCCTCGAGCCGCCCCAGCTCGCCCAGGTCAAGAAGCAGCTC
GACGAGGAACTCGAACACCTAACGTCGTCTTATGCGCAGCTTCACAGCGCCCAGACGCGCTTCCGCGATTGCTTG
CGCTGCTGCGTCGCGGCCCATGGCGACGGCACCTCTGCGCTCTCTGACAAGGTGCTCGTTCCTCTGACAAACTCG
CTCTACGTCCATGCAACTCTTGCGGCAAAGGATCGTGTCCTAGTCGACATTGGCACTGGGTTTTTGATTGAAAAG
AAACTTGAATCGGCAGAGAAATACTACGACTCCAAAGTCCAGGACCTGACGAGCAACCTCAAGGAGCTCGAGGCC
ATTGTGCAGCGCAAACAGTCAAACGTCATGGCAGTAGAGGAAGTGCTGAGACAGAAGCTGATGGCGGCTCAAGCA
TCACAATCATAG
Transcript >OphauB2|5581
ATGCCCGGCGAGCGCGAAACCATTCACCTCGACAGCCTCGAGCCGCCCCAGCTCGCCCAGGTCAAGAAGCAGCTC
GACGAGGAACTCGAACACCTAACGTCGTCTTATGCGCAGCTTCACAGCGCCCAGACGCGCTTCCGCGATTGCTTG
CGCTGCTGCGTCGCGGCCCATGGCGACGGCACCTCTGCGCTCTCTGACAAGGTGCTCGTTCCTCTGACAAACTCG
CTCTACGTCCATGCAACTCTTGCGGCAAAGGATCGTGTCCTAGTCGACATTGGCACTGGGTTTTTGATTGAAAAG
AAACTTGAATCGGCAGAGAAATACTACGACTCCAAAGTCCAGGACCTGACGAGCAACCTCAAGGAGCTCGAGGCC
ATTGTGCAGCGCAAACAGTCAAACGTCATGGCAGTAGAGGAAGTGCTGAGACAGAAGCTGATGGCGGCTCAAGCA
TCACAATCATAG
Gene >OphauB2|5581
ATGCCCGGCGAGCGCGAAACCAGTACGTCTTGGCCTTTCTACCTTCTTCTCCCACCCTCAACACTCTCTCCTCAC
AACAACTAACCCCTCGCCAAAAAAAGTTCACCTCGACAGCCTCGAGCCGCCCCAGCTCGCCCAGGTCAAGAAGCA
GCTCGACGAGGAACTCGAACACCTAACGTCGTCTTATGCGCAGCTTCACAGCGCCCAGACGCGCTTCCGCGATTG
CTTGCGCTGCTGCGTCGCGGCCCATGGCGACGGCACCTCTGCGCTCTCTGACAAGGTGCTCGTTCCTCTGACAAA
CTCGCTCTACGTCCATGCAACTCTTGCGGCAAAGGATCGTGTCCTAGTCGACATTGGCACTGGGTTTTTGATTGA
AAAGGTGTGCCTTCTTGTCGTCTTTGTGCTTGTATCCTGGGCTCTGCCCCTCGTCATTCAAATGACCTCACTGAT
CTCTGCATACACATCGCCGACACATTTTACAAGACAGCTAAATTTTTGGCCAGAAACTTGAATCGGCAGAGAAAT
ACTACGACTCCAAAGTCCAGGACCTGACGAGCAACCTCAAGGAGCTCGAGGCCATTGTGCAGCGCAAACAGTCAA
ACGTCATGGCAGTAGAGGAAGGTACGTTTGCCGTGCTCTTGCACCTGTCTTGTTGGGGAAAGCCGTTTCCATGTG
CTTCATGTTGCCTCTTGGCTGACACTTGCCTCTCTCTCTTAGTGCTGAGACAGAAGCTGATGGCGGCTCAAGCAT
CACAATCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail