Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5574
Gene name
LocationContig_44:59488..61764
Strand+
Gene length (bp)2276
Transcript length (bp)2112
Coding sequence length (bp)2112
Protein length (aa) 704

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.6E-06 481 503
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.2E-03 509 531
PF13894 zf-C2H2_4 C2H2-type zinc finger 7.9E-04 481 503
PF13912 zf-C2H2_6 C2H2-type zinc finger 9.4E-04 481 505
PF12874 zf-met Zinc-finger of C2H2 type 1.5E-02 481 503

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 475 588 3.0E-49
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 471 581 1.0E-45
sp|Q59SN6|CRZ2_CANAL Transcriptional regulator CRZ2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ2 PE=2 SV=1 480 578 9.0E-33
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 486 575 2.0E-28
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 455 574 7.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 475 588 3.0E-49
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 471 581 1.0E-45
sp|Q59SN6|CRZ2_CANAL Transcriptional regulator CRZ2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ2 PE=2 SV=1 480 578 9.0E-33
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 486 575 2.0E-28
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 455 574 7.0E-17
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 455 567 9.0E-17
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 455 567 1.0E-16
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 389 567 3.0E-15
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 470 568 3.0E-15
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 470 568 4.0E-15
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 486 567 4.0E-15
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 470 568 4.0E-15
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 472 573 6.0E-15
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 470 568 6.0E-15
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 472 573 1.0E-14
sp|O14258|ACE2_SCHPO Metallothionein expression activator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ace2 PE=3 SV=1 484 574 1.0E-14
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 486 567 1.0E-14
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 472 573 1.0E-14
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 486 567 1.0E-14
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 472 573 2.0E-14
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 486 567 2.0E-14
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 486 567 2.0E-14
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 481 570 2.0E-14
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 475 564 3.0E-14
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 458 535 3.0E-14
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 455 535 3.0E-14
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 481 564 3.0E-14
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 481 564 3.0E-14
sp|Q59RR0|ACE2_CANAL Cell wall transcription factor ACE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACE2 PE=3 SV=1 406 574 4.0E-14
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 389 567 4.0E-14
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 458 535 4.0E-14
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 458 535 4.0E-14
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 481 564 4.0E-14
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 458 535 5.0E-14
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 481 564 5.0E-14
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 481 564 5.0E-14
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 481 564 6.0E-14
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 481 564 6.0E-14
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 460 570 6.0E-14
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 458 535 6.0E-14
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 458 535 7.0E-14
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 481 566 7.0E-14
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 481 564 7.0E-14
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 458 535 7.0E-14
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 569 7.0E-14
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 481 564 7.0E-14
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 458 535 8.0E-14
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 481 564 8.0E-14
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 481 564 9.0E-14
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 481 564 9.0E-14
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 458 535 9.0E-14
sp|Q5XJQ7|OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio GN=osr1 PE=2 SV=1 481 564 1.0E-13
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 444 564 1.0E-13
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 481 585 1.0E-13
sp|Q6NRM8|ZB183_XENLA Zinc finger and BTB domain-containing protein 18.3 OS=Xenopus laevis GN=zbtb18.3 PE=2 SV=1 483 566 1.0E-13
sp|Q0IJ29|ZBT18_XENTR Zinc finger and BTB domain-containing protein 18 OS=Xenopus tropicalis GN=zbtb18 PE=2 SV=1 483 566 1.0E-13
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 464 567 1.0E-13
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 460 567 1.0E-13
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 486 567 1.0E-13
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 464 567 1.0E-13
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 464 567 1.0E-13
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 464 567 2.0E-13
sp|Q1L8W0|ZBT18_DANRE Zinc finger and BTB domain-containing protein 18 OS=Danio rerio GN=zbtb18 PE=2 SV=1 483 566 2.0E-13
sp|Q9WUK6|ZBT18_MOUSE Zinc finger and BTB domain-containing protein 18 OS=Mus musculus GN=Zbtb18 PE=1 SV=1 483 566 2.0E-13
sp|A0JN76|ZBT18_BOVIN Zinc finger and BTB domain-containing protein 18 OS=Bos taurus GN=ZBTB18 PE=2 SV=2 483 566 2.0E-13
sp|Q99592|ZBT18_HUMAN Zinc finger and BTB domain-containing protein 18 OS=Homo sapiens GN=ZBTB18 PE=1 SV=1 483 566 2.0E-13
sp|Q9JKY3|ZBT18_RAT Zinc finger and BTB domain-containing protein 18 OS=Rattus norvegicus GN=Zbtb18 PE=1 SV=1 483 566 2.0E-13
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 481 570 2.0E-13
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 481 567 3.0E-13
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 481 564 3.0E-13
sp|A8MUZ8|Z705G_HUMAN Putative zinc finger protein 705G OS=Homo sapiens GN=ZNF705G PE=2 SV=2 472 573 3.0E-13
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 458 536 3.0E-13
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 481 564 3.0E-13
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 458 536 3.0E-13
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 458 536 3.0E-13
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 481 564 3.0E-13
sp|Q801P1|ZBT18_XENLA Zinc finger and BTB domain-containing protein 18 OS=Xenopus laevis GN=zbtb18 PE=2 SV=2 483 566 3.0E-13
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 481 567 4.0E-13
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 456 566 4.0E-13
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 227 570 4.0E-13
sp|Q8VCZ7|ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus GN=Zbtb7c PE=2 SV=1 470 572 4.0E-13
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 456 566 4.0E-13
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 457 580 5.0E-13
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 481 570 6.0E-13
sp|P08153|SWI5_YEAST Transcriptional factor SWI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI5 PE=1 SV=1 468 564 7.0E-13
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 458 536 7.0E-13
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 458 536 7.0E-13
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 481 593 7.0E-13
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 458 536 7.0E-13
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 458 536 8.0E-13
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 486 567 8.0E-13
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 458 536 8.0E-13
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 481 570 9.0E-13
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 458 536 1.0E-12
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 481 593 1.0E-12
sp|P21192|ACE2_YEAST Metallothionein expression activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACE2 PE=1 SV=1 481 573 1.0E-12
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 473 570 1.0E-12
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 470 580 1.0E-12
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 481 570 1.0E-12
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 486 566 1.0E-12
sp|Q7ZWZ4|ZB182_XENLA Zinc finger and BTB domain-containing protein 18.2 OS=Xenopus laevis GN=zbtb18.2 PE=2 SV=2 483 566 1.0E-12
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 481 623 1.0E-12
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 435 567 2.0E-12
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 435 567 2.0E-12
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 486 567 2.0E-12
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 486 567 2.0E-12
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 486 567 2.0E-12
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 469 570 2.0E-12
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 435 569 2.0E-12
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 486 567 2.0E-12
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 481 570 2.0E-12
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 384 582 2.0E-12
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 435 567 3.0E-12
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 462 535 3.0E-12
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 481 566 3.0E-12
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 481 566 3.0E-12
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 481 566 3.0E-12
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 481 566 3.0E-12
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 481 566 3.0E-12
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 462 535 3.0E-12
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 477 570 3.0E-12
sp|P19382|SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis GN=snai1 PE=1 SV=1 453 564 3.0E-12
sp|Q5U2Z0|ZN367_RAT Zinc finger protein 367 OS=Rattus norvegicus GN=Znf367 PE=2 SV=1 481 559 3.0E-12
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 472 587 3.0E-12
sp|Q0VDT2|ZN367_MOUSE Zinc finger protein 367 OS=Mus musculus GN=Znf367 PE=1 SV=2 481 559 3.0E-12
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 462 535 3.0E-12
sp|B1WBS3|ZBT42_RAT Zinc finger and BTB domain-containing protein 42 OS=Rattus norvegicus GN=Zbtb42 PE=2 SV=1 483 578 3.0E-12
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 479 570 3.0E-12
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 478 580 4.0E-12
sp|Q811H0|ZBT42_MOUSE Zinc finger and BTB domain-containing protein 42 OS=Mus musculus GN=Zbtb42 PE=1 SV=2 483 578 4.0E-12
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 585 4.0E-12
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 477 570 4.0E-12
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 478 580 4.0E-12
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 477 570 4.0E-12
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 478 580 4.0E-12
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 481 571 4.0E-12
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 481 566 4.0E-12
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 478 580 5.0E-12
sp|Q567C6|ZN367_DANRE Zinc finger protein 367 OS=Danio rerio GN=znf367 PE=2 SV=1 481 559 5.0E-12
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 481 570 5.0E-12
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 480 571 5.0E-12
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 477 570 5.0E-12
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 477 570 5.0E-12
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 486 569 5.0E-12
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 481 566 6.0E-12
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 481 566 6.0E-12
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 486 569 6.0E-12
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 474 590 6.0E-12
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 477 570 6.0E-12
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 477 570 6.0E-12
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 465 564 6.0E-12
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 472 570 7.0E-12
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 474 590 7.0E-12
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 412 581 7.0E-12
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 481 593 7.0E-12
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 462 535 7.0E-12
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 478 580 8.0E-12
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 481 591 8.0E-12
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 465 564 8.0E-12
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 590 8.0E-12
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 477 570 8.0E-12
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 481 578 9.0E-12
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 481 570 9.0E-12
sp|Q9QY31|SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus GN=Snai3 PE=2 SV=1 453 570 9.0E-12
sp|P25932|ESCA_DROME Protein escargot OS=Drosophila melanogaster GN=esg PE=1 SV=2 468 564 1.0E-11
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 481 564 1.0E-11
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 478 580 1.0E-11
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 478 580 1.0E-11
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 481 566 1.0E-11
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 1.0E-11
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 432 575 1.0E-11
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 473 564 1.0E-11
sp|O08954|SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus GN=Snai2 PE=2 SV=2 453 564 1.0E-11
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 481 570 1.0E-11
sp|Q3MHQ4|SNAI2_BOVIN Zinc finger protein SNAI2 OS=Bos taurus GN=SNAI2 PE=2 SV=1 453 564 1.0E-11
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 449 565 1.0E-11
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 570 1.0E-11
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 481 570 1.0E-11
sp|Q3KNW1|SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens GN=SNAI3 PE=2 SV=1 451 564 1.0E-11
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 478 580 1.0E-11
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 480 590 1.0E-11
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 481 588 1.0E-11
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 480 571 1.0E-11
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 481 622 1.0E-11
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 477 570 1.0E-11
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 477 570 1.0E-11
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 576 1.0E-11
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 453 564 1.0E-11
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 477 570 2.0E-11
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 472 540 2.0E-11
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 486 566 2.0E-11
sp|Q6DCW1|GFI1B_XENLA Zinc finger protein Gfi-1b OS=Xenopus laevis GN=gfi1b PE=2 SV=1 474 590 2.0E-11
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 480 577 2.0E-11
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 473 570 2.0E-11
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 481 582 2.0E-11
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 472 569 2.0E-11
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 481 573 2.0E-11
sp|O43623|SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens GN=SNAI2 PE=1 SV=1 453 564 2.0E-11
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 566 2.0E-11
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 481 564 2.0E-11
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 486 566 2.0E-11
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 2.0E-11
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 2.0E-11
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 481 564 2.0E-11
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 438 570 2.0E-11
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 570 2.0E-11
sp|Q7RTV3|ZN367_HUMAN Zinc finger protein 367 OS=Homo sapiens GN=ZNF367 PE=1 SV=1 481 559 2.0E-11
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 481 580 2.0E-11
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 486 566 3.0E-11
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 481 566 3.0E-11
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 486 566 3.0E-11
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 486 566 3.0E-11
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 486 566 3.0E-11
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 481 540 3.0E-11
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 486 570 3.0E-11
sp|Q8BID6|ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus GN=Zbtb46 PE=1 SV=2 481 573 3.0E-11
sp|Q08876|SUHW_DROVI Protein suppressor of hairy wing OS=Drosophila virilis GN=su(Hw) PE=2 SV=1 481 585 3.0E-11
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 481 540 3.0E-11
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 481 571 3.0E-11
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 460 571 3.0E-11
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 486 584 3.0E-11
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 472 540 3.0E-11
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 481 581 3.0E-11
sp|Q8IZ20|ZN683_HUMAN Zinc finger protein 683 OS=Homo sapiens GN=ZNF683 PE=2 SV=3 481 608 3.0E-11
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 481 575 3.0E-11
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 472 570 3.0E-11
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 486 584 3.0E-11
sp|Q86UZ6|ZBT46_HUMAN Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens GN=ZBTB46 PE=1 SV=2 481 573 3.0E-11
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 483 588 4.0E-11
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 482 571 4.0E-11
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 470 648 4.0E-11
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 4.0E-11
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 570 4.0E-11
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 473 570 4.0E-11
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 481 588 4.0E-11
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 481 588 4.0E-11
sp|Q91924|SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis GN=snai2 PE=1 SV=1 453 564 4.0E-11
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 462 570 4.0E-11
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 481 588 4.0E-11
sp|B2RXF5|ZBT42_HUMAN Zinc finger and BTB domain-containing protein 42 OS=Homo sapiens GN=ZBTB42 PE=1 SV=2 483 567 4.0E-11
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 486 570 4.0E-11
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 472 540 4.0E-11
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 481 565 4.0E-11
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 481 567 4.0E-11
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 477 570 4.0E-11
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 483 588 5.0E-11
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 481 578 5.0E-11
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 564 5.0E-11
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 475 570 5.0E-11
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 472 569 5.0E-11
sp|Q02085|SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus GN=Snai1 PE=1 SV=1 456 564 5.0E-11
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 570 5.0E-11
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 5.0E-11
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 481 570 5.0E-11
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 481 570 5.0E-11
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 570 5.0E-11
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 481 585 5.0E-11
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 584 6.0E-11
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 6.0E-11
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 486 566 6.0E-11
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 474 564 6.0E-11
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 473 570 6.0E-11
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 481 570 6.0E-11
sp|O15156|ZBT7B_HUMAN Zinc finger and BTB domain-containing protein 7B OS=Homo sapiens GN=ZBTB7B PE=1 SV=2 470 575 6.0E-11
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 478 585 6.0E-11
sp|Q8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens GN=ZBTB38 PE=1 SV=2 481 570 6.0E-11
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 486 571 6.0E-11
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 481 567 7.0E-11
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 472 540 7.0E-11
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 486 591 7.0E-11
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 486 591 7.0E-11
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 473 570 7.0E-11
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 481 570 7.0E-11
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 473 570 8.0E-11
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 477 570 8.0E-11
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 480 580 8.0E-11
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 585 8.0E-11
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 472 590 8.0E-11
sp|Q99M85|SCRT1_MOUSE Transcriptional repressor scratch 1 OS=Mus musculus GN=Scrt1 PE=1 SV=1 471 567 8.0E-11
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 472 590 8.0E-11
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 481 540 8.0E-11
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 481 540 8.0E-11
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 480 575 8.0E-11
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 481 564 8.0E-11
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 480 566 9.0E-11
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 481 570 9.0E-11
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 481 581 9.0E-11
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 486 584 9.0E-11
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 481 570 9.0E-11
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 481 570 9.0E-11
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 461 564 9.0E-11
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 481 570 9.0E-11
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 481 571 9.0E-11
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 481 567 9.0E-11
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 480 566 9.0E-11
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 472 590 9.0E-11
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 564 9.0E-11
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 457 539 1.0E-10
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 480 566 1.0E-10
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 457 539 1.0E-10
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 481 581 1.0E-10
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 480 570 1.0E-10
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 462 566 1.0E-10
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 474 564 1.0E-10
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 474 564 1.0E-10
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 472 540 1.0E-10
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 472 540 1.0E-10
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 471 566 1.0E-10
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 481 570 1.0E-10
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 481 570 1.0E-10
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 481 570 1.0E-10
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 486 584 1.0E-10
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 481 570 1.0E-10
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 462 571 1.0E-10
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 481 567 1.0E-10
sp|Q5EXX3|ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus GN=Zbtb38 PE=2 SV=1 481 570 1.0E-10
sp|Q7K0S9|GLIS2_DROME Zinc finger protein GLIS2 homolog OS=Drosophila melanogaster GN=sug PE=2 SV=1 482 567 1.0E-10
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 481 564 1.0E-10
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 472 590 1.0E-10
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 567 1.0E-10
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 481 565 1.0E-10
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 486 591 1.0E-10
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 486 591 1.0E-10
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 486 595 1.0E-10
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 483 567 1.0E-10
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 483 570 1.0E-10
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 481 571 1.0E-10
sp|O77027|CI_DROYA Protein cubitus interruptus (Fragment) OS=Drosophila yakuba GN=ci PE=3 SV=1 486 570 1.0E-10
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 433 570 1.0E-10
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 472 570 1.0E-10
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 1.0E-10
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 486 564 2.0E-10
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 481 570 2.0E-10
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 481 567 2.0E-10
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 473 570 2.0E-10
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 594 2.0E-10
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 455 539 2.0E-10
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 481 540 2.0E-10
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 461 566 2.0E-10
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 481 569 2.0E-10
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 566 2.0E-10
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 2.0E-10
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 481 540 2.0E-10
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 483 570 2.0E-10
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 2.0E-10
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 440 570 2.0E-10
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 472 570 2.0E-10
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 472 570 2.0E-10
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 440 570 2.0E-10
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 483 570 2.0E-10
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 472 570 2.0E-10
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 480 570 2.0E-10
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 481 587 2.0E-10
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 481 571 2.0E-10
sp|Q64321|ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus GN=Zbtb7b PE=1 SV=2 470 575 2.0E-10
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 481 570 2.0E-10
sp|P18719|ZG32_XENLA Gastrula zinc finger protein XlCGF32.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 476 570 2.0E-10
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 483 570 2.0E-10
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 481 567 2.0E-10
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 486 570 2.0E-10
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 470 566 2.0E-10
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 482 570 2.0E-10
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 481 570 2.0E-10
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 463 570 2.0E-10
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 483 564 2.0E-10
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 481 570 2.0E-10
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 482 531 2.0E-10
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 486 564 2.0E-10
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 482 570 2.0E-10
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 438 570 2.0E-10
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 480 569 2.0E-10
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 481 571 2.0E-10
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 486 570 2.0E-10
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 481 570 2.0E-10
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 472 570 2.0E-10
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 486 565 2.0E-10
sp|Q9BWW7|SCRT1_HUMAN Transcriptional repressor scratch 1 OS=Homo sapiens GN=SCRT1 PE=1 SV=1 471 567 2.0E-10
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 476 570 2.0E-10
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 472 570 2.0E-10
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 582 2.0E-10
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 486 584 2.0E-10
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 470 570 2.0E-10
sp|Q0GGX2|ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus GN=Znf541 PE=1 SV=1 481 574 2.0E-10
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 3.0E-10
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 431 567 3.0E-10
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 477 564 3.0E-10
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 477 564 3.0E-10
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 477 564 3.0E-10
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 472 567 3.0E-10
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 481 570 3.0E-10
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 481 576 3.0E-10
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 473 570 3.0E-10
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 384 564 3.0E-10
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 472 570 3.0E-10
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 474 564 3.0E-10
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 472 570 3.0E-10
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 481 539 3.0E-10
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 481 581 3.0E-10
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 473 569 3.0E-10
sp|P16374|ZFP60_MOUSE Zinc finger protein 60 OS=Mus musculus GN=Zfp60 PE=2 SV=2 481 565 3.0E-10
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 480 570 3.0E-10
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 472 571 3.0E-10
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 480 569 3.0E-10
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 481 570 3.0E-10
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 481 570 3.0E-10
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 442 570 3.0E-10
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 472 566 3.0E-10
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 486 565 3.0E-10
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 480 566 3.0E-10
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 486 566 3.0E-10
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 481 570 3.0E-10
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 486 565 3.0E-10
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 472 570 3.0E-10
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 481 570 3.0E-10
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 472 588 3.0E-10
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 486 584 3.0E-10
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 472 566 3.0E-10
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 481 588 3.0E-10
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 413 566 3.0E-10
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 481 570 3.0E-10
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 482 565 3.0E-10
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 482 602 3.0E-10
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 570 3.0E-10
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 481 570 4.0E-10
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 481 566 4.0E-10
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 631 4.0E-10
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 384 564 4.0E-10
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 481 577 4.0E-10
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 481 581 4.0E-10
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 472 582 4.0E-10
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 470 570 4.0E-10
sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=2 SV=1 472 572 4.0E-10
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 486 571 4.0E-10
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 473 570 4.0E-10
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 480 570 4.0E-10
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 481 579 4.0E-10
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 481 594 4.0E-10
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 472 570 4.0E-10
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 473 588 4.0E-10
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 481 581 4.0E-10
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 481 594 4.0E-10
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 481 570 4.0E-10
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 472 570 4.0E-10
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 469 591 4.0E-10
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 472 570 4.0E-10
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 480 570 4.0E-10
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 472 570 4.0E-10
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 481 570 4.0E-10
sp|Q8N895|ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens GN=ZNF366 PE=1 SV=1 481 572 4.0E-10
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 486 564 5.0E-10
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 486 566 5.0E-10
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 454 587 5.0E-10
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 436 575 5.0E-10
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 481 570 5.0E-10
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 406 570 5.0E-10
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 384 564 5.0E-10
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 5.0E-10
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 481 571 5.0E-10
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 481 570 5.0E-10
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 481 570 5.0E-10
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 481 570 5.0E-10
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 481 594 5.0E-10
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 481 570 5.0E-10
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 481 594 5.0E-10
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 472 570 5.0E-10
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 463 566 5.0E-10
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 481 570 5.0E-10
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 486 565 5.0E-10
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 481 570 5.0E-10
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 472 539 5.0E-10
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 481 594 5.0E-10
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 472 570 5.0E-10
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 469 585 5.0E-10
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 486 564 5.0E-10
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 472 566 5.0E-10
sp|Q8VHT7|TF3A_MOUSE Transcription factor IIIA OS=Mus musculus GN=Gtf3a PE=2 SV=2 478 570 5.0E-10
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 566 5.0E-10
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 481 570 5.0E-10
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 486 564 5.0E-10
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 483 570 5.0E-10
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 478 584 5.0E-10
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 567 6.0E-10
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 481 594 6.0E-10
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 481 576 6.0E-10
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 481 576 6.0E-10
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 481 566 6.0E-10
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 481 570 6.0E-10
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 481 576 6.0E-10
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 481 570 6.0E-10
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 481 570 6.0E-10
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 481 564 6.0E-10
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 481 571 6.0E-10
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 478 564 6.0E-10
sp|Q92664|TF3A_HUMAN Transcription factor IIIA OS=Homo sapiens GN=GTF3A PE=1 SV=3 478 565 6.0E-10
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 462 583 6.0E-10
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 474 540 6.0E-10
sp|Q96MM3|ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens GN=ZFP42 PE=1 SV=2 483 569 6.0E-10
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 469 582 6.0E-10
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 486 564 6.0E-10
sp|Q1H9T6|ZBT48_MOUSE Zinc finger and BTB domain-containing protein 48 OS=Mus musculus GN=Zbtb48 PE=1 SV=1 481 583 6.0E-10
sp|Q3URS2|ZSC4F_MOUSE Zinc finger and SCAN domain containing protein 4F OS=Mus musculus GN=Zscan4f PE=2 SV=2 483 567 6.0E-10
sp|Q80VJ6|ZSC4C_MOUSE Zinc finger and SCAN domain containing protein 4C OS=Mus musculus GN=Zscan4c PE=2 SV=1 483 567 6.0E-10
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 481 570 6.0E-10
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 394 566 6.0E-10
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 457 539 7.0E-10
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 564 7.0E-10
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 486 564 7.0E-10
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 486 566 7.0E-10
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 486 566 7.0E-10
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 473 566 7.0E-10
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 472 567 7.0E-10
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 481 570 7.0E-10
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 404 582 7.0E-10
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 472 570 7.0E-10
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 458 540 7.0E-10
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 476 570 7.0E-10
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 462 570 7.0E-10
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 481 570 7.0E-10
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 482 602 7.0E-10
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 482 602 7.0E-10
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 570 7.0E-10
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 481 570 7.0E-10
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 478 584 7.0E-10
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 570 7.0E-10
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 482 578 7.0E-10
sp|A6QR00|ZN526_BOVIN Zinc finger protein 526 OS=Bos taurus GN=ZNF526 PE=2 SV=1 482 566 7.0E-10
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 386 570 7.0E-10
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 481 570 7.0E-10
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 470 627 8.0E-10
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 457 539 8.0E-10
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 486 564 8.0E-10
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 486 566 8.0E-10
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 481 570 8.0E-10
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 481 570 8.0E-10
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 477 564 8.0E-10
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 481 594 8.0E-10
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 449 570 8.0E-10
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 481 564 8.0E-10
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 474 564 8.0E-10
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 470 570 8.0E-10
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 571 8.0E-10
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 481 567 8.0E-10
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 481 581 8.0E-10
sp|A7KBS4|ZSC4D_MOUSE Zinc finger and SCAN domain containing protein 4D OS=Mus musculus GN=Zscan4d PE=2 SV=1 483 567 8.0E-10
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 388 566 8.0E-10
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 486 564 8.0E-10
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 481 570 8.0E-10
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 482 564 8.0E-10
sp|A1L1R6|ZN423_DANRE Zinc finger protein 423 OS=Danio rerio GN=znf423 PE=2 SV=1 483 567 8.0E-10
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 472 570 8.0E-10
sp|Q08875|SUHW_DROAN Protein suppressor of hairy wing OS=Drosophila ananassae GN=su(Hw) PE=2 SV=1 481 596 8.0E-10
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 481 567 8.0E-10
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 472 570 8.0E-10
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 472 566 8.0E-10
sp|P10074|ZBT48_HUMAN Zinc finger and BTB domain-containing protein 48 OS=Homo sapiens GN=ZBTB48 PE=1 SV=2 483 583 8.0E-10
sp|D2HQI1|ZSCA4_AILME Zinc finger and SCAN domain-containing protein 4 OS=Ailuropoda melanoleuca GN=ZSCAN4 PE=3 SV=1 464 570 8.0E-10
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 481 570 8.0E-10
sp|Q9NQX0|PRDM6_HUMAN Putative histone-lysine N-methyltransferase PRDM6 OS=Homo sapiens GN=PRDM6 PE=2 SV=2 397 566 8.0E-10
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 8.0E-10
sp|Q96K83|ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens GN=ZNF521 PE=1 SV=1 483 593 8.0E-10
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 457 539 9.0E-10
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 481 577 9.0E-10
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 462 570 9.0E-10
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 472 567 9.0E-10
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 483 571 9.0E-10
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 474 564 9.0E-10
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 481 570 9.0E-10
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 473 570 9.0E-10
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 481 540 9.0E-10
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 481 579 9.0E-10
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 490 564 9.0E-10
sp|Q2M1K9|ZN423_HUMAN Zinc finger protein 423 OS=Homo sapiens GN=ZNF423 PE=1 SV=1 483 637 9.0E-10
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 432 570 9.0E-10
sp|Q5R633|ZBT48_PONAB Zinc finger and BTB domain-containing protein 48 OS=Pongo abelii GN=ZBTB48 PE=2 SV=1 483 583 9.0E-10
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 475 566 9.0E-10
sp|Q15697|ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens GN=ZNF174 PE=1 SV=1 481 570 9.0E-10
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 481 570 9.0E-10
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 470 627 1.0E-09
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 486 564 1.0E-09
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 472 567 1.0E-09
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 481 527 1.0E-09
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 481 577 1.0E-09
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 570 1.0E-09
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 479 582 1.0E-09
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 481 581 1.0E-09
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 584 1.0E-09
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 481 581 1.0E-09
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 570 1.0E-09
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 481 566 1.0E-09
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 1.0E-09
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 473 570 1.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 440 570 1.0E-09
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 1.0E-09
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 481 585 1.0E-09
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 481 567 1.0E-09
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 472 570 1.0E-09
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 481 573 1.0E-09
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 481 570 1.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 481 570 1.0E-09
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 486 613 1.0E-09
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 463 572 1.0E-09
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 472 570 1.0E-09
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 481 570 1.0E-09
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 472 570 1.0E-09
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 570 1.0E-09
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 472 566 1.0E-09
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 481 570 1.0E-09
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 481 564 1.0E-09
sp|Q6NUD7|ZN521_XENLA Zinc finger protein 521 OS=Xenopus laevis GN=znf521 PE=2 SV=1 483 593 1.0E-09
sp|Q8VHT8|TF3A_RAT Transcription factor IIIA OS=Rattus norvegicus GN=Gtf3a PE=2 SV=2 478 565 1.0E-09
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 481 570 1.0E-09
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 472 588 1.0E-09
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 481 570 1.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 481 570 1.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 481 570 1.0E-09
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 481 570 1.0E-09
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 481 567 1.0E-09
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 481 570 1.0E-09
sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens GN=HIC2 PE=1 SV=2 478 570 1.0E-09
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 481 567 1.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 472 581 1.0E-09
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 481 577 1.0E-09
sp|Q8NAM6|ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens GN=ZSCAN4 PE=2 SV=1 470 570 1.0E-09
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 484 566 1.0E-09
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 394 566 1.0E-09
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 388 566 1.0E-09
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 481 570 1.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 481 570 1.0E-09
sp|Q9H0D2|ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens GN=ZNF541 PE=2 SV=3 481 574 1.0E-09
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 481 567 1.0E-09
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 483 567 1.0E-09
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 483 570 1.0E-09
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 440 575 1.0E-09
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 481 567 1.0E-09
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 475 566 1.0E-09
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 473 566 1.0E-09
sp|Q6KAS7|ZN521_MOUSE Zinc finger protein 521 OS=Mus musculus GN=Znf521 PE=1 SV=2 483 593 1.0E-09
sp|Q3UZD5|PRDM6_MOUSE Putative histone-lysine N-methyltransferase PRDM6 OS=Mus musculus GN=Prdm6 PE=1 SV=1 397 566 1.0E-09
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 470 564 1.0E-09
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 480 585 1.0E-09
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 443 570 1.0E-09
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 481 570 1.0E-09
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 473 570 1.0E-09
sp|Q8BI66|ZN526_MOUSE Zinc finger protein 526 OS=Mus musculus GN=Znf526 PE=2 SV=1 482 566 1.0E-09
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 481 570 1.0E-09
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 482 571 2.0E-09
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 482 571 2.0E-09
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 482 539 2.0E-09
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 482 539 2.0E-09
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 482 539 2.0E-09
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 590 2.0E-09
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 481 527 2.0E-09
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 481 527 2.0E-09
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 2.0E-09
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 481 527 2.0E-09
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 481 571 2.0E-09
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 570 2.0E-09
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 481 570 2.0E-09
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 473 539 2.0E-09
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 486 566 2.0E-09
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 472 575 2.0E-09
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 481 582 2.0E-09
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 481 582 2.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 481 570 2.0E-09
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 481 569 2.0E-09
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 471 571 2.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 384 564 2.0E-09
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 472 581 2.0E-09
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 481 570 2.0E-09
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 481 570 2.0E-09
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 472 571 2.0E-09
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 564 2.0E-09
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 570 2.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 481 570 2.0E-09
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 481 539 2.0E-09
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 483 570 2.0E-09
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 481 570 2.0E-09
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 472 570 2.0E-09
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 2.0E-09
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 481 572 2.0E-09
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 481 582 2.0E-09
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 570 2.0E-09
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 481 572 2.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 481 570 2.0E-09
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 481 570 2.0E-09
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 455 583 2.0E-09
sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens GN=HIC2 PE=1 SV=2 481 566 2.0E-09
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 481 564 2.0E-09
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 486 564 2.0E-09
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 481 570 2.0E-09
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 481 643 2.0E-09
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 473 570 2.0E-09
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 481 570 2.0E-09
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 473 570 2.0E-09
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 482 570 2.0E-09
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 486 566 2.0E-09
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 486 566 2.0E-09
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 469 570 2.0E-09
sp|Q80TS5|ZN423_MOUSE Zinc finger protein 423 OS=Mus musculus GN=Znf423 PE=1 SV=2 483 637 2.0E-09
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 481 572 2.0E-09
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 462 566 3.0E-09
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 482 539 3.0E-09
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 482 539 3.0E-09
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 472 566 3.0E-09
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 482 539 3.0E-09
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 483 570 3.0E-09
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 631 3.0E-09
sp|Q08876|SUHW_DROVI Protein suppressor of hairy wing OS=Drosophila virilis GN=su(Hw) PE=2 SV=1 444 570 3.0E-09
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 3.0E-09
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 471 571 3.0E-09
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 481 527 3.0E-09
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 481 539 3.0E-09
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 481 539 3.0E-09
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 481 570 3.0E-09
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 481 571 3.0E-09
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 473 566 3.0E-09
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 481 571 3.0E-09
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 570 3.0E-09
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 481 570 3.0E-09
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 481 570 3.0E-09
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 481 570 3.0E-09
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 481 539 3.0E-09
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 478 564 3.0E-09
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 570 3.0E-09
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 472 570 3.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 481 570 3.0E-09
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 462 570 3.0E-09
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 462 570 3.0E-09
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 462 570 3.0E-09
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 462 570 3.0E-09
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 476 570 4.0E-09
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 482 539 4.0E-09
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 482 539 4.0E-09
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 473 566 4.0E-09
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 473 566 4.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 482 570 4.0E-09
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 481 570 4.0E-09
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 481 575 4.0E-09
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 481 585 4.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 481 570 4.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 481 570 4.0E-09
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 481 570 4.0E-09
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 448 539 4.0E-09
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 330 581 4.0E-09
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 481 566 4.0E-09
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 482 571 4.0E-09
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 481 570 4.0E-09
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 481 591 4.0E-09
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 473 570 4.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 481 570 4.0E-09
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 4.0E-09
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 570 4.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 481 571 4.0E-09
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 481 571 4.0E-09
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 481 570 4.0E-09
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 483 589 5.0E-09
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 462 564 5.0E-09
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 462 533 5.0E-09
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 467 532 5.0E-09
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 482 539 5.0E-09
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 482 539 5.0E-09
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 481 570 5.0E-09
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 570 5.0E-09
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 472 566 5.0E-09
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 482 539 5.0E-09
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 462 539 5.0E-09
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 472 570 5.0E-09
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 472 570 5.0E-09
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 371 570 5.0E-09
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 481 539 5.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 481 582 5.0E-09
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 570 5.0E-09
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 481 572 5.0E-09
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 472 572 5.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 481 570 5.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 472 564 5.0E-09
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 483 570 5.0E-09
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 481 570 6.0E-09
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 481 566 6.0E-09
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 481 571 6.0E-09
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 398 571 6.0E-09
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 570 6.0E-09
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 472 567 6.0E-09
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 481 570 6.0E-09
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 473 564 6.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 481 570 6.0E-09
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 472 567 6.0E-09
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 481 628 6.0E-09
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 477 570 6.0E-09
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 481 570 6.0E-09
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 472 570 6.0E-09
sp|D2HQI1|ZSCA4_AILME Zinc finger and SCAN domain-containing protein 4 OS=Ailuropoda melanoleuca GN=ZSCAN4 PE=3 SV=1 472 567 6.0E-09
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 481 564 6.0E-09
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 570 7.0E-09
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 473 582 7.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 473 570 7.0E-09
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 539 7.0E-09
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 472 570 7.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 481 567 7.0E-09
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 481 566 7.0E-09
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 481 570 7.0E-09
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 481 589 7.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 472 570 7.0E-09
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 482 585 8.0E-09
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 482 571 8.0E-09
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 457 570 8.0E-09
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 457 570 8.0E-09
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 481 539 8.0E-09
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 481 570 8.0E-09
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 481 564 8.0E-09
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 474 564 8.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 481 581 8.0E-09
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 472 575 8.0E-09
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 481 566 8.0E-09
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 481 570 8.0E-09
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 481 566 8.0E-09
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 482 587 8.0E-09
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 440 567 8.0E-09
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 433 576 8.0E-09
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 472 570 8.0E-09
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 481 527 9.0E-09
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 481 571 9.0E-09
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 474 540 9.0E-09
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 455 570 9.0E-09
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 570 9.0E-09
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 575 9.0E-09
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 481 570 1.0E-08
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 481 527 1.0E-08
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 481 527 1.0E-08
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 481 527 1.0E-08
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 481 581 1.0E-08
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 481 581 1.0E-08
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 481 570 1.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 472 566 1.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 472 570 1.0E-08
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 481 573 1.0E-08
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 564 1.0E-08
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 1.0E-08
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 433 570 1.0E-08
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 481 570 1.0E-08
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 481 540 1.0E-08
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 481 573 1.0E-08
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 483 570 1.0E-08
sp|O15156|ZBT7B_HUMAN Zinc finger and BTB domain-containing protein 7B OS=Homo sapiens GN=ZBTB7B PE=1 SV=2 464 590 1.0E-08
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 481 540 1.0E-08
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 481 573 1.0E-08
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 481 576 1.0E-08
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 458 571 1.0E-08
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 472 566 1.0E-08
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 473 566 1.0E-08
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 473 566 1.0E-08
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 473 566 1.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 483 588 1.0E-08
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 481 570 1.0E-08
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 472 566 1.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 481 570 1.0E-08
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 472 567 1.0E-08
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 481 570 1.0E-08
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 472 570 1.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 570 1.0E-08
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 472 570 1.0E-08
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 472 571 1.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 471 569 1.0E-08
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 473 566 1.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 582 1.0E-08
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 481 571 1.0E-08
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 481 575 1.0E-08
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 481 587 1.0E-08
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 481 549 1.0E-08
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 481 575 1.0E-08
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 481 587 1.0E-08
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 433 570 1.0E-08
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 570 1.0E-08
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 570 1.0E-08
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 1.0E-08
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 462 575 1.0E-08
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 481 582 1.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 481 570 1.0E-08
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 486 568 1.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 481 570 1.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 481 539 1.0E-08
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 481 628 1.0E-08
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 481 570 1.0E-08
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 472 570 1.0E-08
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 481 570 2.0E-08
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 481 527 2.0E-08
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 570 2.0E-08
sp|Q6DCW1|GFI1B_XENLA Zinc finger protein Gfi-1b OS=Xenopus laevis GN=gfi1b PE=2 SV=1 480 565 2.0E-08
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 582 2.0E-08
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 481 573 2.0E-08
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 472 566 2.0E-08
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 481 569 2.0E-08
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 481 570 2.0E-08
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 477 571 2.0E-08
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 481 570 2.0E-08
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 481 632 2.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 480 597 2.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 473 564 2.0E-08
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 481 613 2.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 473 564 2.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 473 564 2.0E-08
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 481 564 2.0E-08
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 472 570 2.0E-08
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 2.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 479 573 2.0E-08
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 474 564 2.0E-08
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 481 570 2.0E-08
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 472 564 2.0E-08
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 481 570 2.0E-08
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 474 564 2.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 483 570 2.0E-08
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 481 566 2.0E-08
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 472 566 2.0E-08
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 473 566 2.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 570 2.0E-08
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 475 571 2.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 481 570 2.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 481 570 2.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 433 570 2.0E-08
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 481 566 2.0E-08
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 481 570 2.0E-08
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 482 566 2.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 472 570 2.0E-08
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 472 570 2.0E-08
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 473 566 2.0E-08
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 481 564 2.0E-08
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 570 2.0E-08
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 473 566 2.0E-08
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 481 566 2.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 433 570 2.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 481 567 2.0E-08
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 481 570 2.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 481 570 2.0E-08
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 472 570 2.0E-08
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 481 566 2.0E-08
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 539 2.0E-08
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 472 570 2.0E-08
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 481 570 2.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 433 570 2.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 481 570 2.0E-08
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 482 570 2.0E-08
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 481 570 2.0E-08
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 481 570 2.0E-08
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 483 589 3.0E-08
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 481 527 3.0E-08
sp|Q9QY31|SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus GN=Snai3 PE=2 SV=1 441 588 3.0E-08
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 473 566 3.0E-08
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 570 3.0E-08
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 570 3.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 573 3.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 570 3.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 481 570 3.0E-08
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 481 573 3.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 570 3.0E-08
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 482 590 3.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 473 564 3.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 483 570 3.0E-08
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 481 570 3.0E-08
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 481 570 3.0E-08
sp|Q5EXX3|ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus GN=Zbtb38 PE=2 SV=1 481 540 3.0E-08
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 462 570 3.0E-08
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 481 570 3.0E-08
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 481 580 3.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 483 570 3.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 481 570 3.0E-08
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 481 570 3.0E-08
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 481 570 3.0E-08
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 481 570 3.0E-08
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 481 570 3.0E-08
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 472 570 3.0E-08
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 472 567 3.0E-08
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 481 570 3.0E-08
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 481 570 3.0E-08
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 481 570 3.0E-08
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 472 570 3.0E-08
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 567 3.0E-08
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 455 570 3.0E-08
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 570 3.0E-08
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 481 570 3.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 472 596 3.0E-08
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 473 570 3.0E-08
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 570 3.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 481 567 3.0E-08
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 481 570 3.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 472 570 3.0E-08
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 481 570 3.0E-08
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 481 570 3.0E-08
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 481 578 3.0E-08
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 4.0E-08
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 483 576 4.0E-08
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 477 566 4.0E-08
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 481 581 4.0E-08
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 477 566 4.0E-08
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 477 566 4.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 472 571 4.0E-08
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 481 570 4.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 566 4.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 569 4.0E-08
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 481 564 4.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 482 576 4.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 483 570 4.0E-08
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 482 565 4.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 457 570 4.0E-08
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 539 4.0E-08
sp|P16374|ZFP60_MOUSE Zinc finger protein 60 OS=Mus musculus GN=Zfp60 PE=2 SV=2 481 540 4.0E-08
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 481 570 4.0E-08
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 481 570 4.0E-08
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 481 539 4.0E-08
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 481 570 4.0E-08
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 482 570 4.0E-08
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 481 570 4.0E-08
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 570 4.0E-08
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 481 570 4.0E-08
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 432 570 4.0E-08
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 486 540 4.0E-08
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 473 566 4.0E-08
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 481 570 4.0E-08
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 473 566 4.0E-08
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 481 582 4.0E-08
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 481 570 4.0E-08
sp|Q08875|SUHW_DROAN Protein suppressor of hairy wing OS=Drosophila ananassae GN=su(Hw) PE=2 SV=1 444 570 4.0E-08
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 481 549 4.0E-08
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 481 570 4.0E-08
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 481 578 4.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 481 570 4.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 481 587 4.0E-08
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 450 571 4.0E-08
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 483 576 5.0E-08
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 473 570 5.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 450 570 5.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 473 540 5.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 464 566 5.0E-08
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 539 5.0E-08
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 571 5.0E-08
sp|Q8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens GN=ZBTB38 PE=1 SV=2 481 571 5.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 482 576 5.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 483 570 5.0E-08
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 481 570 5.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 483 570 5.0E-08
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 486 587 5.0E-08
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 457 570 5.0E-08
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 486 587 5.0E-08
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 481 564 5.0E-08
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 435 570 5.0E-08
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 472 570 5.0E-08
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 481 581 5.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 481 570 5.0E-08
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 481 570 5.0E-08
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 481 589 5.0E-08
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 481 564 5.0E-08
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 481 578 5.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 481 566 5.0E-08
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 570 5.0E-08
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 481 570 5.0E-08
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 481 566 5.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 472 532 5.0E-08
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 462 575 5.0E-08
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 480 570 6.0E-08
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 481 570 6.0E-08
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 481 570 6.0E-08
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 481 570 6.0E-08
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 481 564 6.0E-08
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 481 581 6.0E-08
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 570 6.0E-08
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 564 6.0E-08
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 481 580 6.0E-08
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 481 567 6.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 482 576 6.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 482 576 6.0E-08
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 481 570 6.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 481 570 6.0E-08
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 481 571 6.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 588 6.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 481 539 6.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 481 570 6.0E-08
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 472 564 6.0E-08
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 481 588 6.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 481 570 6.0E-08
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 481 570 6.0E-08
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 481 570 6.0E-08
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 577 6.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 481 577 6.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 481 570 6.0E-08
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 481 570 6.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 459 570 7.0E-08
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 481 564 7.0E-08
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 481 564 7.0E-08
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 481 564 7.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 472 570 7.0E-08
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 481 535 7.0E-08
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 531 7.0E-08
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 482 570 7.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 570 7.0E-08
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 472 570 7.0E-08
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 472 587 7.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 483 570 7.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 481 582 7.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 472 567 7.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 481 570 7.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 481 539 7.0E-08
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 481 567 7.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 481 567 7.0E-08
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 480 564 7.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 472 596 7.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 472 564 7.0E-08
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 472 582 7.0E-08
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 400 570 7.0E-08
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 481 540 7.0E-08
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 472 570 7.0E-08
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 481 564 8.0E-08
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 535 8.0E-08
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 501 570 8.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 570 8.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 570 8.0E-08
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 501 570 8.0E-08
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 483 566 8.0E-08
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 481 576 8.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 481 566 8.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 472 570 8.0E-08
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 481 588 8.0E-08
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 472 539 8.0E-08
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 564 8.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 482 570 8.0E-08
sp|Q8NAM6|ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens GN=ZSCAN4 PE=2 SV=1 472 567 8.0E-08
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 481 570 8.0E-08
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 481 540 9.0E-08
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 483 567 9.0E-08
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 481 581 9.0E-08
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 570 9.0E-08
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 9.0E-08
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 501 570 9.0E-08
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 501 570 9.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 588 9.0E-08
sp|Q64321|ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus GN=Zbtb7b PE=1 SV=2 469 590 9.0E-08
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 481 564 9.0E-08
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 462 605 9.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 432 570 9.0E-08
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 473 564 9.0E-08
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 411 578 9.0E-08
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 570 9.0E-08
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 481 582 9.0E-08
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 481 607 9.0E-08
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 473 570 9.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 432 566 9.0E-08
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 481 537 1.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 481 570 1.0E-07
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 472 538 1.0E-07
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 472 538 1.0E-07
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 481 570 1.0E-07
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 481 570 1.0E-07
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 481 540 1.0E-07
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 472 536 1.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 472 570 1.0E-07
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 480 565 1.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 481 577 1.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 564 1.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 463 570 1.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 481 570 1.0E-07
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 481 570 1.0E-07
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 481 585 1.0E-07
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 501 570 1.0E-07
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 501 570 1.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 481 570 1.0E-07
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 474 570 1.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 566 1.0E-07
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 472 533 1.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 481 570 1.0E-07
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 481 566 1.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 481 571 1.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 421 570 1.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 483 570 1.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 486 587 1.0E-07
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 465 580 1.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 453 570 1.0E-07
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 481 570 1.0E-07
sp|P16374|ZFP60_MOUSE Zinc finger protein 60 OS=Mus musculus GN=Zfp60 PE=2 SV=2 481 566 1.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 480 585 1.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 480 585 1.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 570 1.0E-07
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 472 570 1.0E-07
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 472 570 1.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 481 570 1.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 480 570 1.0E-07
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 481 539 1.0E-07
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 499 570 1.0E-07
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 472 570 1.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 570 1.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 570 1.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 481 570 1.0E-07
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 481 570 1.0E-07
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 481 567 1.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 481 549 1.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 481 540 1.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 481 570 1.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 458 582 1.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 472 539 1.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 480 570 1.0E-07
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 481 582 1.0E-07
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 481 570 1.0E-07
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 433 566 1.0E-07
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 481 570 1.0E-07
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 481 570 1.0E-07
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 483 685 1.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 481 570 1.0E-07
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 481 583 1.0E-07
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 471 570 1.0E-07
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 531 2.0E-07
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 481 544 2.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 481 544 2.0E-07
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 481 570 2.0E-07
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 482 570 2.0E-07
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 539 2.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 481 582 2.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 462 582 2.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 472 570 2.0E-07
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 480 585 2.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 462 570 2.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 481 564 2.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 481 570 2.0E-07
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 481 564 2.0E-07
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 483 570 2.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 482 570 2.0E-07
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 473 629 2.0E-07
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 473 570 2.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 472 570 2.0E-07
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 472 570 2.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 483 570 2.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 481 570 2.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 462 570 2.0E-07
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 483 582 2.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 570 2.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 481 570 2.0E-07
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 481 569 2.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 462 564 2.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 472 570 2.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 481 577 2.0E-07
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 481 573 2.0E-07
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 472 570 2.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 462 564 2.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 481 570 2.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 472 564 2.0E-07
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 483 630 2.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 481 567 2.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 481 582 2.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 585 2.0E-07
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 2.0E-07
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 2.0E-07
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 462 570 2.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 481 587 2.0E-07
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 481 570 2.0E-07
sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens GN=HIC2 PE=1 SV=2 481 532 2.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 481 570 2.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 481 566 2.0E-07
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 470 570 2.0E-07
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 472 539 2.0E-07
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 474 539 2.0E-07
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 482 570 2.0E-07
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 472 539 2.0E-07
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 481 537 3.0E-07
sp|A8MUZ8|Z705G_HUMAN Putative zinc finger protein 705G OS=Homo sapiens GN=ZNF705G PE=2 SV=2 457 539 3.0E-07
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 481 531 3.0E-07
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 481 531 3.0E-07
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 481 531 3.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 481 570 3.0E-07
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 480 565 3.0E-07
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 490 564 3.0E-07
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 483 576 3.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 481 570 3.0E-07
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 482 570 3.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 570 3.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 570 3.0E-07
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 570 3.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 479 567 3.0E-07
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 483 635 3.0E-07
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 470 539 3.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 462 573 3.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 483 570 3.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 433 578 3.0E-07
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 478 570 3.0E-07
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 483 539 3.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 458 582 3.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 472 570 3.0E-07
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 472 539 3.0E-07
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 472 570 3.0E-07
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 483 602 3.0E-07
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 478 567 3.0E-07
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 481 570 3.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 457 570 3.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 481 570 3.0E-07
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 475 567 3.0E-07
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 481 539 3.0E-07
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 481 531 4.0E-07
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 483 567 4.0E-07
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 467 580 4.0E-07
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 482 539 4.0E-07
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 483 564 4.0E-07
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 482 566 4.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 581 4.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 572 4.0E-07
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 4.0E-07
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 473 570 4.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 481 570 4.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 472 570 4.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 483 578 4.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 473 570 4.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 570 4.0E-07
sp|P16374|ZFP60_MOUSE Zinc finger protein 60 OS=Mus musculus GN=Zfp60 PE=2 SV=2 481 540 4.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 472 570 4.0E-07
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 481 594 4.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 539 4.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 481 570 4.0E-07
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 481 538 4.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 496 570 4.0E-07
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 457 535 4.0E-07
sp|Q8N895|ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens GN=ZNF366 PE=1 SV=1 478 584 4.0E-07
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 481 564 4.0E-07
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 478 567 4.0E-07
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 483 602 4.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 570 4.0E-07
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 481 567 4.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 481 570 4.0E-07
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 472 570 4.0E-07
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 470 570 4.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 481 582 4.0E-07
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 470 570 4.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 481 570 4.0E-07
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 470 570 4.0E-07
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 481 570 4.0E-07
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 481 578 4.0E-07
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 482 532 5.0E-07
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 481 531 5.0E-07
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 481 531 5.0E-07
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 570 5.0E-07
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 570 5.0E-07
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 481 540 5.0E-07
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 473 571 5.0E-07
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 481 539 5.0E-07
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 473 571 5.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 481 578 5.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 481 570 5.0E-07
sp|P16374|ZFP60_MOUSE Zinc finger protein 60 OS=Mus musculus GN=Zfp60 PE=2 SV=2 480 571 5.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 481 570 5.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 433 570 5.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 481 570 5.0E-07
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 479 570 5.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 480 564 5.0E-07
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 570 5.0E-07
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 478 570 5.0E-07
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 453 578 5.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 481 570 5.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 472 564 5.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 481 588 5.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 481 570 5.0E-07
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 482 539 5.0E-07
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 482 567 5.0E-07
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 482 539 5.0E-07
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 482 567 5.0E-07
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 482 539 5.0E-07
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 470 570 5.0E-07
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 482 539 5.0E-07
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 445 535 5.0E-07
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 481 531 6.0E-07
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 472 582 6.0E-07
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 482 570 6.0E-07
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 585 6.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 481 575 6.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 433 578 6.0E-07
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 481 570 6.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 481 571 6.0E-07
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 481 570 6.0E-07
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 458 570 6.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 481 582 6.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 478 566 6.0E-07
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 481 564 6.0E-07
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 482 567 6.0E-07
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 482 567 6.0E-07
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 457 564 6.0E-07
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 483 567 7.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 453 566 7.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 462 566 7.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 482 570 7.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 482 570 7.0E-07
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 472 570 7.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 481 535 7.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 481 571 7.0E-07
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 481 582 7.0E-07
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 483 570 7.0E-07
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 481 571 7.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 474 570 7.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 476 570 7.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 481 570 8.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 620 8.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 566 8.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 481 570 8.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 564 8.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 433 570 8.0E-07
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 480 570 8.0E-07
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 570 8.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 433 567 8.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 570 8.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 478 567 8.0E-07
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 470 628 8.0E-07
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 470 571 9.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 570 9.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 570 9.0E-07
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 480 565 9.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 481 571 9.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 481 571 9.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 481 578 9.0E-07
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 480 565 9.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 481 569 9.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 481 564 9.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 481 567 9.0E-07
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 481 570 9.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 481 564 9.0E-07
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 449 565 1.0E-06
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 432 566 1.0E-06
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 472 577 1.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 462 535 1.0E-06
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 531 1.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 481 570 1.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 540 1.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 483 570 1.0E-06
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 480 564 1.0E-06
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 531 1.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 570 1.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 570 1.0E-06
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 490 564 1.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 481 598 1.0E-06
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 480 565 1.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 481 570 1.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 481 570 1.0E-06
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 481 570 1.0E-06
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 481 567 1.0E-06
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 480 565 1.0E-06
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 462 535 1.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 481 539 1.0E-06
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 593 1.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 462 539 1.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 462 570 1.0E-06
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 531 1.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 481 588 1.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 570 1.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 472 570 1.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 481 570 1.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 472 566 1.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 462 573 1.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 460 570 1.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 481 570 1.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 443 570 1.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 462 573 1.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 483 570 1.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 481 570 1.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 432 570 1.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 481 570 1.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 570 1.0E-06
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 472 535 1.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 433 570 1.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 481 663 1.0E-06
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 481 570 1.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 481 570 1.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 481 570 1.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 481 571 1.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 472 570 1.0E-06
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 473 582 1.0E-06
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 481 539 1.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 472 570 1.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 481 570 1.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 481 576 1.0E-06
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 481 567 1.0E-06
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 481 570 1.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 472 564 1.0E-06
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 483 581 1.0E-06
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 481 539 1.0E-06
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 481 535 2.0E-06
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 481 535 2.0E-06
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 482 532 2.0E-06
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 479 627 2.0E-06
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 470 571 2.0E-06
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 470 570 2.0E-06
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 482 537 2.0E-06
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 481 532 2.0E-06
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 481 539 2.0E-06
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 481 565 2.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 481 570 2.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 480 570 2.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 480 578 2.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 481 570 2.0E-06
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 481 570 2.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 570 2.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 464 540 2.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 539 2.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 581 2.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 543 2.0E-06
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 473 561 2.0E-06
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 490 564 2.0E-06
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 490 564 2.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 588 2.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 472 551 2.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 433 570 2.0E-06
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 481 570 2.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 471 570 2.0E-06
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 531 2.0E-06
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 481 570 2.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 483 570 2.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 481 570 2.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 481 570 2.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 469 570 2.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 472 538 2.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 481 570 2.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 539 2.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 539 2.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 480 570 2.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 472 570 2.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 472 539 2.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 481 570 2.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 480 570 2.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 472 532 2.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 481 570 2.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 481 567 2.0E-06
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 531 2.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 481 570 2.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 481 570 2.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 564 2.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 481 570 2.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 481 570 2.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 443 570 2.0E-06
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 433 570 2.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 472 569 2.0E-06
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 483 537 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 481 570 2.0E-06
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 481 570 2.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 481 570 2.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 481 570 2.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 472 570 2.0E-06
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 481 570 2.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 481 570 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 481 570 2.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 481 577 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 458 570 2.0E-06
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 481 570 2.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 482 570 2.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 473 570 2.0E-06
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 472 566 2.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 465 581 2.0E-06
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 482 537 3.0E-06
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 432 566 3.0E-06
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 432 566 3.0E-06
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 432 566 3.0E-06
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 480 564 3.0E-06
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 575 3.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 540 3.0E-06
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 481 570 3.0E-06
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 3.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 481 570 3.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 433 570 3.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 481 570 3.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 479 567 3.0E-06
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 481 570 3.0E-06
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 481 588 3.0E-06
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 539 3.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 433 535 3.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 481 567 3.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 570 3.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 582 3.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 481 570 3.0E-06
sp|P16374|ZFP60_MOUSE Zinc finger protein 60 OS=Mus musculus GN=Zfp60 PE=2 SV=2 481 564 3.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 481 570 3.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 481 539 3.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 570 3.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 472 570 3.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 481 567 3.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 433 578 3.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 481 539 3.0E-06
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 481 588 3.0E-06
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 481 567 3.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 472 570 3.0E-06
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 481 570 3.0E-06
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 462 564 3.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 3.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 472 566 3.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 481 570 3.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 481 570 3.0E-06
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 481 545 4.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 481 531 4.0E-06
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 432 566 4.0E-06
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 481 567 4.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 482 534 4.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 481 570 4.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 433 570 4.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 481 570 4.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 433 570 4.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 472 539 4.0E-06
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 570 4.0E-06
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 539 4.0E-06
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 481 570 4.0E-06
sp|P16374|ZFP60_MOUSE Zinc finger protein 60 OS=Mus musculus GN=Zfp60 PE=2 SV=2 480 566 4.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 472 540 4.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 480 580 4.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 481 539 4.0E-06
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 472 575 4.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 472 587 4.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 472 539 4.0E-06
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 481 570 4.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 462 535 4.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 481 570 4.0E-06
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 462 535 4.0E-06
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 481 573 4.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 4.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 539 4.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 4.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 481 570 4.0E-06
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 472 570 4.0E-06
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 462 535 4.0E-06
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 462 535 4.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 481 570 4.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 481 549 4.0E-06
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 481 545 5.0E-06
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 481 545 5.0E-06
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 481 545 5.0E-06
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 432 566 5.0E-06
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 474 576 5.0E-06
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 570 5.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 481 575 5.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 481 531 5.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 481 570 5.0E-06
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 482 535 5.0E-06
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 482 535 5.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 481 539 5.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 481 539 5.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 471 570 5.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 472 539 5.0E-06
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 479 540 5.0E-06
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 482 535 5.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 481 570 5.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 481 536 5.0E-06
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 481 564 5.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 481 570 5.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 481 570 5.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 481 569 5.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 481 570 5.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 481 539 5.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 385 570 5.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 481 539 5.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 481 570 5.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 481 539 5.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 481 573 5.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 481 570 5.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 481 539 5.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 481 539 5.0E-06
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 480 564 5.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 481 570 5.0E-06
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 432 566 6.0E-06
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 481 567 6.0E-06
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 481 540 6.0E-06
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 481 536 6.0E-06
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 481 534 6.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 479 567 6.0E-06
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 482 535 6.0E-06
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 479 574 6.0E-06
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 481 535 6.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 481 537 6.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 472 570 6.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 481 539 6.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 481 535 6.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 481 536 6.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 472 570 6.0E-06
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 472 540 6.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 472 539 6.0E-06
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 481 539 6.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 482 567 6.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 481 570 6.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 481 570 6.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 481 573 6.0E-06
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 483 570 6.0E-06
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 478 539 6.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 481 531 7.0E-06
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 432 567 7.0E-06
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 481 536 7.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 481 570 7.0E-06
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 432 566 7.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 472 539 7.0E-06
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 582 7.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 462 570 7.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 480 570 7.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 474 539 7.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 481 570 7.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 472 539 7.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 570 7.0E-06
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 472 566 7.0E-06
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 481 570 7.0E-06
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 481 570 7.0E-06
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 482 599 7.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 472 539 7.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 473 539 7.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 481 564 7.0E-06
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 472 567 8.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 538 8.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 481 570 8.0E-06
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 479 574 8.0E-06
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 481 578 8.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 481 535 8.0E-06
sp|Q96MM3|ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens GN=ZFP42 PE=1 SV=2 486 570 8.0E-06
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 481 570 8.0E-06
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 482 599 8.0E-06
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 481 539 8.0E-06
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 481 570 8.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 481 570 8.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 481 545 8.0E-06
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 470 531 9.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 481 535 9.0E-06
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 473 530 9.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 481 569 9.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 481 564 9.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 473 570 9.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 472 549 9.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 481 535 9.0E-06
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 481 570 9.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 481 570 9.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 481 582 9.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 474 570 9.0E-06
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 481 531 9.0E-06
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 472 570 9.0E-06
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 481 566 9.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 481 535 1.0E-05
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 481 531 1.0E-05
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 472 570 1.0E-05
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 472 588 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5574
MDQQAHSGRCEPSTPAPVELDISQSALSSSAAGPGVGLGLYSSHHSNSLQQQPPSAFDTDPAFDAPSPLAADFVD
SHPHQPQPQRSPYSPHSNESPSDSAAFDPSLPFGQDATSSVAAPHSRPPSASYLSSNFHHGDFSLFPSSGGQADH
YTSPSLFEQSATLSPGNLSNMASPQSHHSPTPPTLLQPDGHRPASTQHSPSFSQSHFSPPSGRHSRNVSLGPEAA
LLPGQIADWTQPQFQRHRRSPSEYSDVSSVSPSPHLVGSDTFDDHGGHSPLQSASDGHLYQEVLNIGNFSIGDTS
HGRSPSHSPAISPRINPQQLPDMGQSGFGLAPPSTGYGTYHVLQQHSDGSFPAMQAPGAQMPTPAINIVHAPNNS
KLGSFEPSKSHMDQDSLTPPDRGGALGRSNNTNSLSPSTASAASRSESSRSLSPLDRQASSSVRGRRQSTSAVPN
NVIALRLADPEYSNSQEGGGAKRVQKHPATFQCNLCPKRFTRAYNLRSHLRTHTDERPFVCTVCGKAFARQHDRK
RHESLHSGEKKFVCKGELKTGGQWGCARRFARADALGRHFRSEAGRICIKPLLDEEMLERQRQWQEQNMQPNMAQ
NMPQPMALDAAPGYPMDAGGNYALPAALLAQYPALAQMNWSQTDTGGGMDDDISGRSSFDASDYDEGEDGSGGYM
SGPGTGFGESNLGPGFGELGYASDFASR*
Coding >OphauB2|5574
ATGGATCAACAGGCCCACAGCGGCCGCTGCGAACCCTCGACTCCGGCCCCGGTAGAGCTTGATATAAGCCAAAGC
GCGCTCTCGTCGTCGGCAGCCGGGCCCGGTGTTGGTCTTGGTCTCTACAGCAGCCATCATTCAAATTCCCTTCAG
CAGCAGCCGCCCTCTGCCTTTGACACTGATCCTGCCTTTGACGCTCCTTCGCCGCTGGCTGCCGACTTTGTCGAC
TCCCACCCGCACCAGCCACAGCCTCAACGCTCCCCCTACTCTCCCCATTCCAACGAGTCCCCCTCAGACTCGGCC
GCTTTCGATCCCAGCCTGCCCTTTGGCCAAGACGCTACCTCGTCTGTTGCCGCCCCTCATTCGCGCCCTCCGTCA
GCGTCGTATCTGTCTTCCAATTTCCATCACGGCGACTTCTCCCTCTTCCCCTCCTCGGGAGGCCAGGCCGACCAC
TACACCAGTCCCTCGCTCTTCGAACAGTCGGCCACGCTTAGCCCTGGCAATCTCAGCAACATGGCGTCGCCCCAA
TCTCATCACTCGCCCACGCCCCCGACACTGCTCCAGCCTGATGGTCATCGGCCTGCCTCGACCCAACACTCCCCC
TCGTTTAGCCAGAGCCACTTCTCTCCGCCATCTGGTCGCCACTCGCGCAACGTCTCTTTAGGTCCCGAAGCCGCT
CTTCTTCCTGGTCAAATAGCCGACTGGACTCAGCCTCAATTCCAGCGCCACCGCCGTAGCCCGTCCGAGTACTCG
GATGTCTCGTCCGTCTCCCCATCTCCTCATCTTGTTGGCTCCGACACCTTTGATGACCACGGTGGTCATTCTCCT
CTGCAGTCAGCGTCAGACGGTCATCTCTACCAGGAGGTGCTCAACATTGGCAACTTTAGTATTGGCGACACGAGC
CACGGCAGAAGCCCTTCTCACAGCCCGGCAATTAGCCCACGAATTAATCCACAGCAGCTGCCCGACATGGGCCAG
TCAGGCTTCGGTCTTGCGCCTCCTAGCACTGGCTACGGCACATATCATGTTTTGCAGCAACACTCTGACGGGTCT
TTTCCCGCAATGCAAGCTCCCGGAGCTCAAATGCCTACCCCGGCTATAAACATTGTCCACGCGCCAAATAATTCC
AAGCTTGGCTCTTTCGAGCCGTCCAAGTCGCATATGGATCAAGACTCTCTGACACCCCCAGACAGAGGTGGTGCT
CTGGGCCGCTCGAATAATACCAACAGCCTGTCACCCTCTACCGCCTCTGCGGCTTCTCGATCCGAATCGTCGCGA
TCTTTGTCGCCCTTGGATCGCCAGGCATCGTCCTCTGTGCGGGGCAGAAGACAATCCACATCGGCGGTGCCCAAT
AACGTCATCGCTCTGCGTCTGGCAGATCCCGAGTATTCAAACAGCCAAGAAGGCGGCGGTGCCAAGCGCGTACAA
AAACATCCTGCAACCTTTCAATGCAACCTGTGTCCCAAGAGATTTACCAGAGCCTATAATCTACGCTCGCATTTG
CGGACCCACACAGATGAGCGGCCTTTTGTCTGCACCGTTTGCGGAAAAGCGTTTGCGCGTCAGCATGACAGAAAA
CGACACGAGAGTCTACATTCGGGCGAAAAGAAGTTTGTCTGCAAGGGCGAGCTCAAGACTGGCGGTCAATGGGGG
TGTGCGCGGCGATTTGCTCGTGCTGACGCTCTTGGACGTCATTTTCGATCAGAGGCCGGTCGCATCTGCATCAAG
CCTCTGCTGGATGAAGAGATGCTTGAGCGACAGCGACAATGGCAAGAACAGAACATGCAACCCAATATGGCCCAG
AATATGCCTCAGCCAATGGCCCTAGACGCCGCTCCGGGTTACCCCATGGACGCGGGGGGCAATTACGCCCTGCCA
GCTGCGCTGCTTGCTCAATACCCAGCTCTAGCACAGATGAACTGGTCACAGACGGATACAGGCGGCGGAATGGAC
GATGATATCAGTGGTCGATCATCTTTTGATGCCAGCGATTATGATGAAGGTGAAGATGGTAGCGGCGGGTATATG
AGTGGCCCTGGTACTGGGTTTGGCGAGAGCAACCTGGGCCCAGGCTTTGGTGAATTGGGATACGCAAGCGATTTT
GCCAGCCGTTGA
Transcript >OphauB2|5574
ATGGATCAACAGGCCCACAGCGGCCGCTGCGAACCCTCGACTCCGGCCCCGGTAGAGCTTGATATAAGCCAAAGC
GCGCTCTCGTCGTCGGCAGCCGGGCCCGGTGTTGGTCTTGGTCTCTACAGCAGCCATCATTCAAATTCCCTTCAG
CAGCAGCCGCCCTCTGCCTTTGACACTGATCCTGCCTTTGACGCTCCTTCGCCGCTGGCTGCCGACTTTGTCGAC
TCCCACCCGCACCAGCCACAGCCTCAACGCTCCCCCTACTCTCCCCATTCCAACGAGTCCCCCTCAGACTCGGCC
GCTTTCGATCCCAGCCTGCCCTTTGGCCAAGACGCTACCTCGTCTGTTGCCGCCCCTCATTCGCGCCCTCCGTCA
GCGTCGTATCTGTCTTCCAATTTCCATCACGGCGACTTCTCCCTCTTCCCCTCCTCGGGAGGCCAGGCCGACCAC
TACACCAGTCCCTCGCTCTTCGAACAGTCGGCCACGCTTAGCCCTGGCAATCTCAGCAACATGGCGTCGCCCCAA
TCTCATCACTCGCCCACGCCCCCGACACTGCTCCAGCCTGATGGTCATCGGCCTGCCTCGACCCAACACTCCCCC
TCGTTTAGCCAGAGCCACTTCTCTCCGCCATCTGGTCGCCACTCGCGCAACGTCTCTTTAGGTCCCGAAGCCGCT
CTTCTTCCTGGTCAAATAGCCGACTGGACTCAGCCTCAATTCCAGCGCCACCGCCGTAGCCCGTCCGAGTACTCG
GATGTCTCGTCCGTCTCCCCATCTCCTCATCTTGTTGGCTCCGACACCTTTGATGACCACGGTGGTCATTCTCCT
CTGCAGTCAGCGTCAGACGGTCATCTCTACCAGGAGGTGCTCAACATTGGCAACTTTAGTATTGGCGACACGAGC
CACGGCAGAAGCCCTTCTCACAGCCCGGCAATTAGCCCACGAATTAATCCACAGCAGCTGCCCGACATGGGCCAG
TCAGGCTTCGGTCTTGCGCCTCCTAGCACTGGCTACGGCACATATCATGTTTTGCAGCAACACTCTGACGGGTCT
TTTCCCGCAATGCAAGCTCCCGGAGCTCAAATGCCTACCCCGGCTATAAACATTGTCCACGCGCCAAATAATTCC
AAGCTTGGCTCTTTCGAGCCGTCCAAGTCGCATATGGATCAAGACTCTCTGACACCCCCAGACAGAGGTGGTGCT
CTGGGCCGCTCGAATAATACCAACAGCCTGTCACCCTCTACCGCCTCTGCGGCTTCTCGATCCGAATCGTCGCGA
TCTTTGTCGCCCTTGGATCGCCAGGCATCGTCCTCTGTGCGGGGCAGAAGACAATCCACATCGGCGGTGCCCAAT
AACGTCATCGCTCTGCGTCTGGCAGATCCCGAGTATTCAAACAGCCAAGAAGGCGGCGGTGCCAAGCGCGTACAA
AAACATCCTGCAACCTTTCAATGCAACCTGTGTCCCAAGAGATTTACCAGAGCCTATAATCTACGCTCGCATTTG
CGGACCCACACAGATGAGCGGCCTTTTGTCTGCACCGTTTGCGGAAAAGCGTTTGCGCGTCAGCATGACAGAAAA
CGACACGAGAGTCTACATTCGGGCGAAAAGAAGTTTGTCTGCAAGGGCGAGCTCAAGACTGGCGGTCAATGGGGG
TGTGCGCGGCGATTTGCTCGTGCTGACGCTCTTGGACGTCATTTTCGATCAGAGGCCGGTCGCATCTGCATCAAG
CCTCTGCTGGATGAAGAGATGCTTGAGCGACAGCGACAATGGCAAGAACAGAACATGCAACCCAATATGGCCCAG
AATATGCCTCAGCCAATGGCCCTAGACGCCGCTCCGGGTTACCCCATGGACGCGGGGGGCAATTACGCCCTGCCA
GCTGCGCTGCTTGCTCAATACCCAGCTCTAGCACAGATGAACTGGTCACAGACGGATACAGGCGGCGGAATGGAC
GATGATATCAGTGGTCGATCATCTTTTGATGCCAGCGATTATGATGAAGGTGAAGATGGTAGCGGCGGGTATATG
AGTGGCCCTGGTACTGGGTTTGGCGAGAGCAACCTGGGCCCAGGCTTTGGTGAATTGGGATACGCAAGCGATTTT
GCCAGCCGTTGA
Gene >OphauB2|5574
ATGGATCAACAGGCCCACAGCGGCCGCTGCGAACCCTCGACTCCGGCCCCGGTAGAGCTTGATATAAGCCAAAGC
GCGCTCTCGTCGTCGGCAGCCGGGCCCGGTGTTGGTCTTGGTCTCTACAGCAGCCATCATTCAAATTCCCTTCAG
CAGCAGCCGCCCTCTGCCTTTGACACTGATCCTGCCTTTGACGCTCCTTCGCCGCTGGCTGCCGACTTTGTCGAC
TCCCACCCGCACCAGCCACAGCCTCAACGCTCCCCCTACTCTCCCCATTCCAACGAGTCCCCCTCAGACTCGGCC
GCTTTCGATCCCAGCCTGCCCTTTGGCCAAGACGCTACCTCGTCTGTTGCCGCCCCTCATTCGCGCCCTCCGTCA
GCGTCGTATCTGTCTTCCAATTTCCATCACGGCGACTTCTCCCTCTTCCCCTCCTCGGGAGGCCAGGCCGACCAC
TACACCAGTCCCTCGCTCTTCGAACAGTCGGCCACGCTTAGCCCTGGCAATCTCAGCAACATGGCGTCGCCCCAA
TCTCATCACTCGCCCACGCCCCCGACACTGCTCCAGCCTGATGGTCATCGGCCTGCCTCGACCCAACACTCCCCC
TCGTTTAGCCAGAGCCACTTCTCTCCGCCATCTGGTCGCCACTCGCGCAACGTCTCTTTAGGTCCCGAAGCCGCT
CTTCTTCCTGGTCAAATAGCCGACTGGACTCAGCCTCAATTCCAGCGCCACCGCCGTAGCCCGTCCGAGTACTCG
GATGTCTCGTCCGTCTCCCCATCTCCTCATCTTGTTGGCTCCGACACCTTTGATGACCACGGTGGTCATTCTCCT
CTGCAGTCAGCGTCAGACGGTCATCTCTACCAGGAGGTGCTCAACATTGGCAACTTTAGTATTGGCGACACGAGC
CACGGCAGAAGCCCTTCTCACAGCCCGGCAATTAGCCCACGAATTAATCCACAGCAGCTGCCCGACATGGGCCAG
TCAGGCTTCGGTCTTGCGCCTCCTAGCACTGGCTACGGCACATATCATGTTTTGCAGCAACACTCTGACGGGTCT
TTTCCCGCAATGCAAGCTCCCGGAGCTCAAATGCCTACCCCGGCTATAAACATTGTCCACGCGCCAAATAATTCC
AAGCTTGGCTCTTTCGAGCCGTCCAAGTCGCATATGGATCAAGACTCTCTGACACCCCCAGACAGAGGTGTGCTT
TTTCTTTTTTTTTTCTCCCTGTCTTGCTTGTCCTTGCTTGGACCATGTTTTGGCGCTTTCGAGGTGCTCCCTTTG
CAACCTACATTACTGATGCAATGGTCATTCTAGGCCGCGTCAAATCTCGCCCTCGGTCTGTTACTGACCCATTTC
ACCCAGGTGGTGCTCTGGGCCGCTCGAATAATACCAACAGCCTGTCACCCTCTACCGCCTCTGCGGCTTCTCGAT
CCGAATCGTCGCGATCTTTGTCGCCCTTGGATCGCCAGGCATCGTCCTCTGTGCGGGGCAGAAGACAATCCACAT
CGGCGGTGCCCAATAACGTCATCGCTCTGCGTCTGGCAGATCCCGAGTATTCAAACAGCCAAGAAGGCGGCGGTG
CCAAGCGCGTACAAAAACATCCTGCAACCTTTCAATGCAACCTGTGTCCCAAGAGATTTACCAGAGCCTATAATC
TACGCTCGCATTTGCGGACCCACACAGATGAGCGGCCTTTTGTCTGCACCGTTTGCGGAAAAGCGTTTGCGCGTC
AGCATGACAGAAAACGACACGAGAGTCTACATTCGGGCGAAAAGAAGTTTGTCTGCAAGGGCGAGCTCAAGACTG
GCGGTCAATGGGGGTGTGCGCGGCGATTTGCTCGTGCTGACGCTCTTGGACGTCATTTTCGATCAGAGGCCGGTC
GCATCTGCATCAAGCCTCTGCTGGATGAAGAGATGCTTGAGCGACAGCGACAATGGCAAGAACAGAACATGCAAC
CCAATATGGCCCAGAATATGCCTCAGCCAATGGCCCTAGACGCCGCTCCGGGTTACCCCATGGACGCGGGGGGCA
ATTACGCCCTGCCAGCTGCGCTGCTTGCTCAATACCCAGCTCTAGCACAGATGAACTGGTCACAGACGGATACAG
GCGGCGGAATGGACGATGATATCAGTGGTCGATCATCTTTTGATGCCAGCGATTATGATGAAGGTGAAGATGGTA
GCGGCGGGTATATGAGTGGCCCTGGTACTGGGTTTGGCGAGAGCAACCTGGGCCCAGGCTTTGGTGAATTGGGAT
ACGCAAGCGATTTTGCCAGCCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail