Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5573
Gene name
LocationContig_44:55424..56602
Strand+
Gene length (bp)1178
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01786 AOX Alternative oxidase 1.4E-91 85 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C206|AOX_PODAS Alternative oxidase, mitochondrial OS=Podospora anserina GN=AOX1 PE=3 SV=1 51 353 6.0E-178
sp|Q01355|AOX_NEUCR Alternative oxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aod-1 PE=1 SV=1 16 353 6.0E-169
sp|O93788|AOX_MAGO7 Alternative oxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=AOX1 PE=2 SV=1 7 353 3.0E-167
sp|Q8J1Z2|AOX_GELSS Alternative oxidase, mitochondrial OS=Gelasinospora sp. (strain S23) GN=aod-1 PE=3 SV=1 48 353 2.0E-165
sp|Q8X1N9|AOX_BLUGR Alternative oxidase, mitochondrial OS=Blumeria graminis PE=3 SV=1 51 353 1.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C206|AOX_PODAS Alternative oxidase, mitochondrial OS=Podospora anserina GN=AOX1 PE=3 SV=1 51 353 6.0E-178
sp|Q01355|AOX_NEUCR Alternative oxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aod-1 PE=1 SV=1 16 353 6.0E-169
sp|O93788|AOX_MAGO7 Alternative oxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=AOX1 PE=2 SV=1 7 353 3.0E-167
sp|Q8J1Z2|AOX_GELSS Alternative oxidase, mitochondrial OS=Gelasinospora sp. (strain S23) GN=aod-1 PE=3 SV=1 48 353 2.0E-165
sp|Q8X1N9|AOX_BLUGR Alternative oxidase, mitochondrial OS=Blumeria graminis PE=3 SV=1 51 353 1.0E-136
sp|Q8NJ59|AOX_BOTFU Alternative oxidase, mitochondrial OS=Botryotinia fuckeliana GN=aox PE=2 SV=1 7 353 3.0E-132
sp|Q96UR9|AOX_MONFR Alternative oxidase, mitochondrial OS=Monilinia fructicola GN=AOX1 PE=3 SV=1 5 353 2.0E-131
sp|O74180|AOX_ASPNG Alternative oxidase, mitochondrial OS=Aspergillus niger GN=aox1 PE=2 SV=2 5 353 1.0E-126
sp|Q9P959|AOX_EMENI Alternative oxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alxA PE=3 SV=2 43 353 2.0E-125
sp|Q9P429|AOX_VENIN Alternative oxidase, mitochondrial OS=Venturia inaequalis GN=AOX1 PE=3 SV=1 51 353 3.0E-125
sp|Q9Y711|AOX_AJECA Alternative oxidase, mitochondrial OS=Ajellomyces capsulatus GN=AOX1 PE=2 SV=1 48 353 9.0E-119
sp|Q9P414|AOX_PICST Alternative oxidase, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=STO1 PE=3 SV=2 1 352 7.0E-86
sp|Q8J0I8|AOX_YARLI Alternative oxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AOX PE=3 SV=1 64 352 9.0E-82
sp|Q00912|AOX_WICAO Alternative oxidase, mitochondrial OS=Wickerhamomyces anomalus GN=AOX1 PE=1 SV=1 76 352 2.0E-81
sp|Q9UV71|AOX2_CANAX Alternative oxidase 2, mitochondrial OS=Candida albicans GN=AOX2 PE=3 SV=1 76 352 8.0E-80
sp|Q8NKE2|AOX_CRYNH Alternative oxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=AOX1 PE=3 SV=2 85 328 4.0E-77
sp|O93853|AOX1_CANAX Alternative oxidase 1, mitochondrial OS=Candida albicans GN=AOX1 PE=3 SV=1 76 352 4.0E-76
sp|Q26710|AOX_TRYBB Alternative oxidase, mitochondrial OS=Trypanosoma brucei brucei GN=AOX PE=1 SV=2 77 351 2.0E-60
sp|F4P6T0|AOX_BATDJ Ubiquinol oxidase, mitochondrial OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=AOX PE=3 SV=1 86 343 2.0E-59
sp|O03376|AOX3_SOYBN Alternative oxidase 3, mitochondrial OS=Glycine max GN=AOX3 PE=1 SV=1 94 328 4.0E-53
sp|Q39219|AOX1A_ARATH Ubiquinol oxidase 1a, mitochondrial OS=Arabidopsis thaliana GN=AOX1A PE=1 SV=2 153 328 6.0E-53
sp|Q40294|AOX1_MANIN Ubiquinol oxidase, mitochondrial OS=Mangifera indica GN=AOMI 1 PE=1 SV=2 97 340 6.0E-53
sp|O23913|AOX1B_ARATH Ubiquinol oxidase 1b, mitochondrial OS=Arabidopsis thaliana GN=AOX1B PE=1 SV=1 153 328 8.0E-53
sp|P22185|AOX1_SAUVE Ubiquinol oxidase 1, mitochondrial OS=Sauromatum venosum GN=AOX1 PE=1 SV=1 150 323 1.0E-52
sp|Q40578|AOX2_TOBAC Ubiquinol oxidase 2, mitochondrial OS=Nicotiana tabacum GN=AOX2 PE=1 SV=2 153 328 5.0E-52
sp|Q41266|AOX2_SOYBN Ubiquinol oxidase 2, mitochondrial OS=Glycine max GN=AOX2 PE=1 SV=2 154 328 7.0E-52
sp|O22048|AOX1C_ARATH Ubiquinol oxidase 1c, mitochondrial OS=Arabidopsis thaliana GN=AOX1C PE=1 SV=1 154 328 3.0E-51
sp|Q41224|AOX1_TOBAC Ubiquinol oxidase 1, mitochondrial OS=Nicotiana tabacum GN=AOX1 PE=1 SV=1 153 328 6.0E-51
sp|O22049|AOX2_ARATH Ubiquinol oxidase 2, mitochondrial OS=Arabidopsis thaliana GN=AOX2 PE=1 SV=2 97 322 8.0E-51
sp|Q07185|AOX1_SOYBN Ubiquinol oxidase 1, mitochondrial OS=Glycine max GN=AOX1 PE=1 SV=1 153 322 1.0E-50
sp|Q8LEE7|AOX3_ARATH Ubiquinol oxidase 3, mitochondrial OS=Arabidopsis thaliana GN=AOX3 PE=2 SV=2 156 328 2.0E-50
sp|D5JAJ1|AOX_TRAHO Ubiquinol oxidase OS=Trachipleistophora hominis GN=AOX PE=1 SV=1 86 318 1.0E-38
[Show less]

GO

GO Term Description Terminal node
GO:0009916 alternative oxidase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor No
GO:0016491 oxidoreductase activity No
GO:0016679 oxidoreductase activity, acting on diphenols and related substances as donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 213 235 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5573
MLSPATVQTRAGAGRQAVKLARAAALGNLYSSYHHAIGLRVGCVQAVSSPRSFSTTRATQLRDFFPSKDTSHILK
TKPAWPHHGYTMEEMEAVVPAHREPRTFSDWAAWKIVRFARYMMDKATGMDRKQQVDKKNPTTAVEAEKPLTEAQ
WLIRFVFLESIAGVPGMVGGMLRHLNSLRRMKRDNGWIETLLEESYNERMHLLTFMKMCEPGWFMKLMIIGAQGV
FFNSLFLAYLANPKVVHRFVGYLEEEAVHTYTRALHEIEQGQLPKWSDPKFQIPDIAIGYWNMPEGHRTMKDLIL
YIRADEAGHRGVNHTLGNLNQKEDPNPFVSTFKDRDVPKPSLKPKGYERSEVI*
Coding >OphauB2|5573
ATGCTATCCCCTGCAACAGTTCAAACCCGGGCTGGCGCTGGACGACAGGCAGTCAAGCTTGCCAGAGCCGCCGCC
CTGGGAAATCTTTACTCGAGTTACCATCATGCCATTGGCCTGAGAGTCGGCTGCGTCCAGGCCGTCTCATCACCC
CGAAGCTTCTCGACAACTCGCGCTACCCAGCTTCGCGACTTCTTTCCCTCCAAGGACACATCCCATATCCTCAAG
ACCAAGCCAGCCTGGCCGCACCATGGCTACACCATGGAGGAGATGGAAGCGGTGGTACCAGCGCATCGCGAGCCG
CGCACCTTTAGCGACTGGGCTGCGTGGAAGATTGTCCGCTTTGCCCGTTACATGATGGACAAGGCAACGGGCATG
GACAGGAAGCAGCAGGTCGACAAAAAGAACCCGACGACGGCTGTTGAGGCCGAGAAGCCTTTGACGGAAGCTCAA
TGGCTCATTCGATTCGTCTTCCTCGAGAGTATCGCCGGTGTGCCGGGCATGGTTGGCGGTATGCTTCGGCACCTA
AACAGCCTGCGACGCATGAAGCGCGACAATGGCTGGATTGAAACTCTGCTGGAAGAAAGCTACAACGAGCGGATG
CATCTCCTGACCTTTATGAAGATGTGTGAGCCCGGCTGGTTCATGAAACTCATGATTATTGGCGCCCAGGGCGTC
TTCTTCAACAGCTTGTTCCTCGCCTACCTGGCCAACCCCAAGGTTGTCCACCGCTTTGTCGGCTATCTCGAGGAG
GAGGCCGTTCACACGTATACGAGGGCCTTGCACGAAATCGAGCAAGGCCAACTTCCCAAGTGGTCGGATCCAAAG
TTCCAGATTCCAGACATTGCCATAGGATACTGGAACATGCCCGAGGGTCACCGTACAATGAAGGACCTCATTCTG
TACATCCGGGCTGACGAGGCCGGTCACCGCGGAGTCAACCATACTCTGGGCAATCTCAACCAGAAAGAAGATCCC
AATCCCTTTGTCAGCACTTTCAAGGACCGCGATGTGCCCAAACCAAGTCTGAAGCCCAAGGGCTACGAGCGATCC
GAGGTCATTTGA
Transcript >OphauB2|5573
ATGCTATCCCCTGCAACAGTTCAAACCCGGGCTGGCGCTGGACGACAGGCAGTCAAGCTTGCCAGAGCCGCCGCC
CTGGGAAATCTTTACTCGAGTTACCATCATGCCATTGGCCTGAGAGTCGGCTGCGTCCAGGCCGTCTCATCACCC
CGAAGCTTCTCGACAACTCGCGCTACCCAGCTTCGCGACTTCTTTCCCTCCAAGGACACATCCCATATCCTCAAG
ACCAAGCCAGCCTGGCCGCACCATGGCTACACCATGGAGGAGATGGAAGCGGTGGTACCAGCGCATCGCGAGCCG
CGCACCTTTAGCGACTGGGCTGCGTGGAAGATTGTCCGCTTTGCCCGTTACATGATGGACAAGGCAACGGGCATG
GACAGGAAGCAGCAGGTCGACAAAAAGAACCCGACGACGGCTGTTGAGGCCGAGAAGCCTTTGACGGAAGCTCAA
TGGCTCATTCGATTCGTCTTCCTCGAGAGTATCGCCGGTGTGCCGGGCATGGTTGGCGGTATGCTTCGGCACCTA
AACAGCCTGCGACGCATGAAGCGCGACAATGGCTGGATTGAAACTCTGCTGGAAGAAAGCTACAACGAGCGGATG
CATCTCCTGACCTTTATGAAGATGTGTGAGCCCGGCTGGTTCATGAAACTCATGATTATTGGCGCCCAGGGCGTC
TTCTTCAACAGCTTGTTCCTCGCCTACCTGGCCAACCCCAAGGTTGTCCACCGCTTTGTCGGCTATCTCGAGGAG
GAGGCCGTTCACACGTATACGAGGGCCTTGCACGAAATCGAGCAAGGCCAACTTCCCAAGTGGTCGGATCCAAAG
TTCCAGATTCCAGACATTGCCATAGGATACTGGAACATGCCCGAGGGTCACCGTACAATGAAGGACCTCATTCTG
TACATCCGGGCTGACGAGGCCGGTCACCGCGGAGTCAACCATACTCTGGGCAATCTCAACCAGAAAGAAGATCCC
AATCCCTTTGTCAGCACTTTCAAGGACCGCGATGTGCCCAAACCAAGTCTGAAGCCCAAGGGCTACGAGCGATCC
GAGGTCATTTGA
Gene >OphauB2|5573
ATGCTATCCCCTGCAACAGTTCAAACCCGGGCTGGCGCTGGACGACAGGCAGTCAAGCTTGCCAGAGCCGCCGCC
CTGGGAAATCTTTACTCGAGTTACCATCATGCCATTGGCCTGAGAGTCGGCTGCGTCCAGGCCGTCTCATCACCC
CGAAGCTTCTCGACAACTCGCGCTACCCAGCTTCGCGACTTCTTTCCCTCCAAGGACACATCCCATATCCTCAAG
ACCAAGCCAGCCTGGCCGCACCATGGCTACACCATGGAGGAGATGGAAGCGGTGGTACCAGCGCATCGCGAGCCG
CGCACCTTTAGCGACTGGGCTGCGTGGAAGATTGTCCGCTTTGCCCGTTACATGATGGACAAGGCAACGGGCATG
GACAGGAAGCAGCAGGTCGACAAAAAGAACCCGACGACGGCTGTTGAGGCCGAGAAGCCTTTGACGGAAGCTCAA
TGGGTATGTCCATCAGCCCCGTCCCCTTTGCTCACTGCTTGAAAGCTGACGCTAGTGCCTTAAGCTCATTCGATT
CGTCTTCCTCGAGAGTATCGCCGGTGTGCCGGGCATGGTTGGCGGTATGCTTCGGCACCTAAACAGCCTGCGACG
CATGAAGCGCGACAATGGCTGGATTGAAACTCTGCTGGAAGAAAGCTACAACGAGCGGATGCATCTCCTGACCTT
TATGAAGATGTGTGAGCCCGGCTGGTTCATGAAACTCATGATTATTGGCGCCCAGGGCGTCTTCTTCAACAGCTT
GTTCCTCGCCTACCTGGCCAACCCCAAGGTTGTCCACCGCTTTGTCGGCTATCTCGAGGAGGAGGCCGTTCACAC
GTATACGAGGGCCTTGCACGAAATCGAGCAAGGCCAACTTCCCAAGTGGTCGGATCCAAAGTTCCAGATTCCAGA
CATTGCCATAGGAGTAAGCGATTACTGTGTCCCATTGGCGCTGCATTTGAGGGCTAACGAGGGTGTAGTACTGGA
ACATGCCCGAGGGTCACCGTACAATGAAGGACCTCATTCTGTACATCCGGGCTGACGAGGCCGGTCACCGCGGAG
TCAACCATACTCTGGGCAATCTCAACCAGAAAGAAGATCCCAATCCCTTTGTCAGCACTTTCAAGGACCGCGATG
TGCCCAAACCAAGTCTGAAGCCCAAGGGCTACGAGCGATCCGAGGTCATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail