Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5568
Gene name
LocationContig_44:39738..43661
Strand-
Gene length (bp)3923
Transcript length (bp)3765
Coding sequence length (bp)3765
Protein length (aa) 1255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1 1.0E-41 61 185
PF00069 Pkinase Protein kinase domain 4.9E-08 1003 1153
PF08171 Mad3_BUB1_II Mad3/BUB1 homology region 2 3.0E-05 322 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94751|BUB1_SCHPO Checkpoint serine/threonine-protein kinase bub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bub1 PE=1 SV=1 846 1247 1.0E-77
sp|P41695|BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB1 PE=1 SV=2 839 1247 3.0E-77
sp|F4IVI0|BUB1_ARATH Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Arabidopsis thaliana GN=BUB1 PE=1 SV=1 960 1245 7.0E-47
sp|O59767|MAD3_SCHPO Mitotic spindle checkpoint component mad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mad3 PE=1 SV=2 8 310 5.0E-38
sp|O08901|BUB1_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Mus musculus GN=Bub1 PE=1 SV=1 847 1254 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94751|BUB1_SCHPO Checkpoint serine/threonine-protein kinase bub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bub1 PE=1 SV=1 846 1247 1.0E-77
sp|P41695|BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB1 PE=1 SV=2 839 1247 3.0E-77
sp|F4IVI0|BUB1_ARATH Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Arabidopsis thaliana GN=BUB1 PE=1 SV=1 960 1245 7.0E-47
sp|O59767|MAD3_SCHPO Mitotic spindle checkpoint component mad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mad3 PE=1 SV=2 8 310 5.0E-38
sp|O08901|BUB1_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Mus musculus GN=Bub1 PE=1 SV=1 847 1254 3.0E-35
sp|O43683|BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens GN=BUB1 PE=1 SV=1 910 1254 7.0E-34
sp|P47074|MAD3_YEAST Spindle assembly checkpoint component MAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAD3 PE=1 SV=1 4 390 6.0E-29
sp|Q9Z1S0|BUB1B_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Mus musculus GN=Bub1b PE=1 SV=2 14 305 1.0E-26
sp|O60566|BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens GN=BUB1B PE=1 SV=3 14 324 2.0E-25
sp|Q54CV5|BUB1_DICDI Probable inactive serine/threonine-protein kinase bub1 OS=Dictyostelium discoideum GN=bub1 PE=3 SV=1 14 211 2.0E-24
sp|Q21776|BUB1_CAEEL Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Caenorhabditis elegans GN=bub-1 PE=1 SV=1 837 1154 2.0E-22
sp|O22806|BUBR1_ARATH Mitotic spindle checkpoint protein BUBR1 OS=Arabidopsis thaliana GN=BUBR1 PE=1 SV=2 73 305 1.0E-20
sp|P41695|BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB1 PE=1 SV=2 75 564 2.0E-20
sp|Q54CV5|BUB1_DICDI Probable inactive serine/threonine-protein kinase bub1 OS=Dictyostelium discoideum GN=bub1 PE=3 SV=1 960 1232 3.0E-19
sp|O94751|BUB1_SCHPO Checkpoint serine/threonine-protein kinase bub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bub1 PE=1 SV=1 46 352 8.0E-14
sp|O08901|BUB1_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Mus musculus GN=Bub1 PE=1 SV=1 64 255 3.0E-13
sp|O43683|BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens GN=BUB1 PE=1 SV=1 65 205 5.0E-13
sp|F4IVI0|BUB1_ARATH Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Arabidopsis thaliana GN=BUB1 PE=1 SV=1 103 211 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5568
MAVSEKTVDFEAIERDKENIQSLPGGRSAKKLVELYSQSPVHKTWTRTAEGDTGRVNECIRAEYEAEVQKIGESD
DPLDVFDRYVQWTLDAYPSAQATAQSQLHTLLERATKAFIGSAQYKNDLRYLKLWLHYIHFFADAPRETYIFLSR
HGIGHSLALFYEEYAAWLEGAGKFCQAEEVYRAGMEREARPVQRLQRKFKEFEARAGRRAQEDLDEASSPALPTA
RPALASKADPFGSAAAPAPQQSRAGNSASSRPAKSKIEVFCDADAQPSALGSHDGASRGWETIDSLAARKKENTI
EAKPWVGQTLKAGGNKTTASELIVFRDASQSQSQSLVNKVAVVPSKSQISVHPQTGKKECVFVHLAVIYPTPDEA
GTELSFEEVIAANRGWLDSDWSEQGTKGESLVGEPAGQVLNEAFVEPRQAALAETVAAAAVDEDRIMYDENGAVK
QEPRARAAGRKKKMMEVNETQIIKAKLDSPLGPKLRKKSTSEATMTIHTRAATDDIYDIFNAPLKAEGEQGQEEE
SAFDDFYETDDDYTVDGTSRVVVDAGEQDTTDAESNGTSRFVGDGADEEQQDDASLDGPSVSAWSDFSTLKHIPS
LGREDKATTAEDGEEEADVDDASVDAAAEETSHGLTDQDSQEDVLAEQAPRTRTIYIPLPPEDCEVPTGPYKDAA
EAANNRLPFMTPITERTEYSMDVEAEFRKRQSKTPSREGLDLGSLESRLVEIVEEQAVLKPAVVEEEEQAVSKLV
VVEEEEEQAVSKPAVVEEEEEQAVSKLVVVEEEEEQAASKPVVVEEEQAVSKPVVVEEEEQAASKPVVVKEQAPL
SRRALAQSKPAKGPIVTEKQCNPVDDGIRQEILSKTHPPLASCAGFFDHRPGKHEGGAEIRRFAKAMARASKGGD
KTPAEIAVGFEDSATTWRVKREIGAGAYAPVYLVERQGEDEADTGTEGGVCSSRRGRLEALKMEQPPTAWEFHMM
RLAQARLGAQDRATASLSVAHELHLYDNEGFLLLPYYAHGTLLDVVNGFRAEAGGAMDEVLAMWLAVELLRTVEA
LHAKGVVHGDIKADNCLLRLDSGAAPASSWRADGSNGWAGRGLVLIDFGRAIDMRAFAPQVEFVADWKTGANDCA
EMREGRPWTWQIDYYGLAGTLHCLLFGRYMDTLRCDDGGLGRTGRRYRIRDALKRYWQTQLWADCFDMLLNPVAH
AAVPGNEERAAMPLLLSMRRVRERMERWLEQNCERGLGLRALLAKVEAQARSRR*
Coding >OphauB2|5568
ATGGCAGTTTCAGAAAAGACTGTCGATTTTGAGGCGATTGAGAGAGACAAGGAAAATATTCAGTCGCTGCCTGGC
GGACGGTCGGCCAAGAAGCTAGTGGAGCTCTACTCACAATCTCCGGTGCACAAAACATGGACACGGACAGCTGAA
GGCGACACAGGGCGGGTGAATGAATGCATACGGGCAGAGTACGAGGCCGAGGTGCAAAAGATTGGCGAATCGGAC
GATCCGCTCGACGTGTTTGACCGGTACGTGCAGTGGACGCTGGACGCGTATCCGTCGGCACAGGCGACAGCACAA
TCACAGCTTCACACATTGTTGGAGCGGGCAACCAAGGCATTTATTGGCTCGGCACAGTACAAGAACGACCTGCGC
TATCTGAAGCTATGGCTGCACTATATTCACTTTTTTGCCGACGCGCCGCGCGAGACGTATATATTTCTGTCGCGC
CATGGCATTGGACATAGCCTGGCGCTCTTTTACGAGGAATACGCCGCGTGGCTGGAGGGCGCGGGCAAGTTTTGC
CAGGCCGAAGAGGTGTACAGGGCAGGCATGGAGCGCGAGGCGCGACCGGTGCAGAGGCTGCAGCGCAAATTCAAA
GAGTTTGAGGCGAGGGCGGGCAGGCGAGCACAAGAGGATTTGGATGAAGCATCGTCGCCGGCACTGCCAACGGCT
CGCCCAGCTCTGGCCTCCAAGGCGGATCCCTTTGGCAGTGCTGCTGCGCCGGCGCCACAGCAGAGCCGTGCTGGC
AATAGTGCTTCGTCGCGGCCTGCCAAGTCCAAGATTGAAGTCTTTTGCGATGCCGACGCGCAGCCGTCTGCCCTG
GGCTCTCACGACGGAGCATCGCGGGGGTGGGAGACGATTGACTCTCTTGCGGCACGGAAAAAGGAGAATACAATA
GAGGCGAAGCCGTGGGTGGGACAGACGCTCAAGGCGGGAGGAAACAAGACGACGGCATCAGAGCTGATTGTCTTT
AGAGATGCGTCTCAGTCTCAGTCTCAGTCTTTAGTAAACAAGGTGGCTGTTGTTCCCTCCAAGAGCCAAATCTCG
GTACATCCCCAGACGGGCAAGAAGGAGTGCGTCTTTGTCCACCTTGCAGTCATTTACCCCACGCCAGATGAAGCC
GGCACTGAGCTGAGCTTTGAGGAGGTCATTGCCGCAAATCGCGGATGGCTTGACTCTGACTGGAGCGAACAAGGC
ACCAAAGGGGAAAGCCTTGTCGGGGAGCCGGCCGGCCAAGTGCTCAACGAGGCTTTTGTAGAGCCAAGGCAGGCT
GCTTTGGCAGAGACTGTTGCTGCTGCTGCTGTTGATGAGGACAGAATAATGTACGATGAAAACGGCGCAGTCAAG
CAAGAGCCTCGGGCACGGGCGGCAGGCCGAAAGAAGAAGATGATGGAGGTGAATGAGACACAGATTATCAAGGCC
AAGCTGGACTCGCCATTGGGTCCCAAGCTGCGCAAAAAAAGCACGTCTGAAGCAACCATGACGATTCACACAAGG
GCAGCCACGGACGACATTTACGATATTTTCAACGCGCCGCTCAAGGCAGAAGGAGAGCAGGGCCAAGAGGAGGAG
AGCGCGTTTGACGATTTCTACGAGACTGACGACGACTACACGGTTGACGGAACAAGCCGAGTCGTTGTTGACGCT
GGCGAGCAAGACACGACGGATGCAGAGAGCAACGGGACGAGTCGTTTTGTTGGCGACGGAGCCGACGAGGAGCAA
CAAGACGACGCATCGCTGGATGGACCAAGCGTGAGCGCATGGTCAGACTTTTCGACTCTCAAGCACATTCCCAGC
CTGGGGCGCGAGGACAAGGCGACGACGGCTGAAGACGGCGAGGAAGAGGCAGATGTGGACGATGCCAGTGTCGAC
GCAGCAGCAGAGGAAACAAGCCATGGATTGACAGACCAAGACAGCCAGGAAGACGTCTTGGCGGAGCAGGCTCCC
AGGACGCGTACAATCTACATCCCGCTCCCGCCAGAAGATTGTGAGGTTCCGACTGGGCCGTATAAGGATGCGGCC
GAGGCGGCCAACAATCGGCTGCCGTTTATGACGCCCATTACGGAGCGGACCGAGTACTCGATGGATGTCGAGGCC
GAGTTTAGAAAGCGGCAGTCCAAGACGCCGAGCAGAGAGGGGCTGGACCTGGGGTCGCTGGAGAGCCGTCTGGTG
GAGATTGTGGAGGAGCAAGCAGTTTTAAAGCCTGCCGTGGTGGAGGAGGAGGAGCAAGCAGTTTCAAAGCTCGTC
GTGGTGGAAGAAGAGGAGGAGCAAGCAGTTTCAAAGCCTGCCGTGGTGGAAGAGGAGGAGGAGCAAGCAGTTTCA
AAGCTCGTCGTGGTGGAAGAGGAGGAGGAGCAAGCAGCATCAAAGCCCGTCGTGGTGGAAGAGGAGCAAGCAGTT
TCAAAGCCCGTCGTGGTGGAAGAAGAGGAGCAAGCAGCATCAAAGCCCGTCGTGGTAAAGGAGCAAGCGCCGCTC
TCCAGGCGTGCCTTGGCGCAAAGCAAGCCAGCCAAGGGACCCATCGTTACCGAAAAGCAGTGCAACCCCGTCGAC
GACGGCATCCGGCAGGAAATCTTGAGCAAGACGCATCCGCCGCTGGCCTCGTGCGCGGGCTTCTTTGACCACAGG
CCGGGCAAACATGAAGGCGGGGCCGAGATTCGGCGCTTTGCCAAGGCCATGGCCAGGGCCAGCAAGGGCGGGGAC
AAGACGCCGGCAGAGATAGCGGTTGGGTTTGAGGATTCGGCAACGACGTGGAGGGTCAAGCGGGAGATTGGCGCC
GGGGCGTATGCACCCGTCTATCTGGTGGAGCGGCAGGGCGAGGACGAGGCGGACACGGGCACGGAGGGCGGGGTG
TGCAGCAGCAGGCGGGGGCGGCTCGAGGCGCTCAAGATGGAGCAGCCGCCGACGGCATGGGAGTTTCACATGATG
AGGCTGGCGCAGGCGCGGCTGGGGGCCCAGGACCGGGCAACGGCATCGCTGTCGGTGGCGCACGAGCTGCACCTG
TACGACAACGAGGGCTTCCTGCTGCTGCCCTACTATGCGCACGGGACGCTGCTCGATGTGGTCAATGGCTTCCGG
GCCGAGGCGGGGGGAGCCATGGACGAGGTGCTGGCCATGTGGCTGGCGGTAGAGCTGCTGCGGACCGTCGAGGCG
CTGCATGCCAAGGGCGTGGTGCACGGCGACATCAAGGCGGACAATTGCCTGCTGCGGCTCGACTCGGGGGCGGCG
CCGGCCTCGTCGTGGAGGGCTGACGGCAGCAACGGCTGGGCGGGCCGCGGGCTGGTGCTCATTGACTTTGGGCGC
GCCATTGACATGCGGGCGTTTGCGCCACAAGTCGAGTTTGTCGCCGACTGGAAGACGGGCGCCAACGACTGCGCC
GAGATGCGCGAGGGCCGCCCCTGGACGTGGCAGATTGACTATTACGGCCTGGCCGGCACCCTGCACTGCCTCCTC
TTTGGCCGCTACATGGACACGCTGCGCTGCGACGACGGCGGCCTGGGACGCACCGGCCGCCGCTACCGCATCCGC
GACGCCCTCAAGCGCTACTGGCAGACGCAGCTGTGGGCCGACTGCTTCGACATGCTGCTCAACCCCGTGGCCCAT
GCCGCCGTCCCGGGCAACGAGGAGCGCGCCGCCATGCCGCTGCTGCTGTCCATGAGGCGTGTGCGGGAGCGCATG
GAGCGCTGGCTTGAGCAGAATTGCGAGAGGGGCCTTGGCCTGCGTGCTCTGCTTGCCAAGGTGGAGGCGCAGGCG
CGGAGCCGTAGGTAG
Transcript >OphauB2|5568
ATGGCAGTTTCAGAAAAGACTGTCGATTTTGAGGCGATTGAGAGAGACAAGGAAAATATTCAGTCGCTGCCTGGC
GGACGGTCGGCCAAGAAGCTAGTGGAGCTCTACTCACAATCTCCGGTGCACAAAACATGGACACGGACAGCTGAA
GGCGACACAGGGCGGGTGAATGAATGCATACGGGCAGAGTACGAGGCCGAGGTGCAAAAGATTGGCGAATCGGAC
GATCCGCTCGACGTGTTTGACCGGTACGTGCAGTGGACGCTGGACGCGTATCCGTCGGCACAGGCGACAGCACAA
TCACAGCTTCACACATTGTTGGAGCGGGCAACCAAGGCATTTATTGGCTCGGCACAGTACAAGAACGACCTGCGC
TATCTGAAGCTATGGCTGCACTATATTCACTTTTTTGCCGACGCGCCGCGCGAGACGTATATATTTCTGTCGCGC
CATGGCATTGGACATAGCCTGGCGCTCTTTTACGAGGAATACGCCGCGTGGCTGGAGGGCGCGGGCAAGTTTTGC
CAGGCCGAAGAGGTGTACAGGGCAGGCATGGAGCGCGAGGCGCGACCGGTGCAGAGGCTGCAGCGCAAATTCAAA
GAGTTTGAGGCGAGGGCGGGCAGGCGAGCACAAGAGGATTTGGATGAAGCATCGTCGCCGGCACTGCCAACGGCT
CGCCCAGCTCTGGCCTCCAAGGCGGATCCCTTTGGCAGTGCTGCTGCGCCGGCGCCACAGCAGAGCCGTGCTGGC
AATAGTGCTTCGTCGCGGCCTGCCAAGTCCAAGATTGAAGTCTTTTGCGATGCCGACGCGCAGCCGTCTGCCCTG
GGCTCTCACGACGGAGCATCGCGGGGGTGGGAGACGATTGACTCTCTTGCGGCACGGAAAAAGGAGAATACAATA
GAGGCGAAGCCGTGGGTGGGACAGACGCTCAAGGCGGGAGGAAACAAGACGACGGCATCAGAGCTGATTGTCTTT
AGAGATGCGTCTCAGTCTCAGTCTCAGTCTTTAGTAAACAAGGTGGCTGTTGTTCCCTCCAAGAGCCAAATCTCG
GTACATCCCCAGACGGGCAAGAAGGAGTGCGTCTTTGTCCACCTTGCAGTCATTTACCCCACGCCAGATGAAGCC
GGCACTGAGCTGAGCTTTGAGGAGGTCATTGCCGCAAATCGCGGATGGCTTGACTCTGACTGGAGCGAACAAGGC
ACCAAAGGGGAAAGCCTTGTCGGGGAGCCGGCCGGCCAAGTGCTCAACGAGGCTTTTGTAGAGCCAAGGCAGGCT
GCTTTGGCAGAGACTGTTGCTGCTGCTGCTGTTGATGAGGACAGAATAATGTACGATGAAAACGGCGCAGTCAAG
CAAGAGCCTCGGGCACGGGCGGCAGGCCGAAAGAAGAAGATGATGGAGGTGAATGAGACACAGATTATCAAGGCC
AAGCTGGACTCGCCATTGGGTCCCAAGCTGCGCAAAAAAAGCACGTCTGAAGCAACCATGACGATTCACACAAGG
GCAGCCACGGACGACATTTACGATATTTTCAACGCGCCGCTCAAGGCAGAAGGAGAGCAGGGCCAAGAGGAGGAG
AGCGCGTTTGACGATTTCTACGAGACTGACGACGACTACACGGTTGACGGAACAAGCCGAGTCGTTGTTGACGCT
GGCGAGCAAGACACGACGGATGCAGAGAGCAACGGGACGAGTCGTTTTGTTGGCGACGGAGCCGACGAGGAGCAA
CAAGACGACGCATCGCTGGATGGACCAAGCGTGAGCGCATGGTCAGACTTTTCGACTCTCAAGCACATTCCCAGC
CTGGGGCGCGAGGACAAGGCGACGACGGCTGAAGACGGCGAGGAAGAGGCAGATGTGGACGATGCCAGTGTCGAC
GCAGCAGCAGAGGAAACAAGCCATGGATTGACAGACCAAGACAGCCAGGAAGACGTCTTGGCGGAGCAGGCTCCC
AGGACGCGTACAATCTACATCCCGCTCCCGCCAGAAGATTGTGAGGTTCCGACTGGGCCGTATAAGGATGCGGCC
GAGGCGGCCAACAATCGGCTGCCGTTTATGACGCCCATTACGGAGCGGACCGAGTACTCGATGGATGTCGAGGCC
GAGTTTAGAAAGCGGCAGTCCAAGACGCCGAGCAGAGAGGGGCTGGACCTGGGGTCGCTGGAGAGCCGTCTGGTG
GAGATTGTGGAGGAGCAAGCAGTTTTAAAGCCTGCCGTGGTGGAGGAGGAGGAGCAAGCAGTTTCAAAGCTCGTC
GTGGTGGAAGAAGAGGAGGAGCAAGCAGTTTCAAAGCCTGCCGTGGTGGAAGAGGAGGAGGAGCAAGCAGTTTCA
AAGCTCGTCGTGGTGGAAGAGGAGGAGGAGCAAGCAGCATCAAAGCCCGTCGTGGTGGAAGAGGAGCAAGCAGTT
TCAAAGCCCGTCGTGGTGGAAGAAGAGGAGCAAGCAGCATCAAAGCCCGTCGTGGTAAAGGAGCAAGCGCCGCTC
TCCAGGCGTGCCTTGGCGCAAAGCAAGCCAGCCAAGGGACCCATCGTTACCGAAAAGCAGTGCAACCCCGTCGAC
GACGGCATCCGGCAGGAAATCTTGAGCAAGACGCATCCGCCGCTGGCCTCGTGCGCGGGCTTCTTTGACCACAGG
CCGGGCAAACATGAAGGCGGGGCCGAGATTCGGCGCTTTGCCAAGGCCATGGCCAGGGCCAGCAAGGGCGGGGAC
AAGACGCCGGCAGAGATAGCGGTTGGGTTTGAGGATTCGGCAACGACGTGGAGGGTCAAGCGGGAGATTGGCGCC
GGGGCGTATGCACCCGTCTATCTGGTGGAGCGGCAGGGCGAGGACGAGGCGGACACGGGCACGGAGGGCGGGGTG
TGCAGCAGCAGGCGGGGGCGGCTCGAGGCGCTCAAGATGGAGCAGCCGCCGACGGCATGGGAGTTTCACATGATG
AGGCTGGCGCAGGCGCGGCTGGGGGCCCAGGACCGGGCAACGGCATCGCTGTCGGTGGCGCACGAGCTGCACCTG
TACGACAACGAGGGCTTCCTGCTGCTGCCCTACTATGCGCACGGGACGCTGCTCGATGTGGTCAATGGCTTCCGG
GCCGAGGCGGGGGGAGCCATGGACGAGGTGCTGGCCATGTGGCTGGCGGTAGAGCTGCTGCGGACCGTCGAGGCG
CTGCATGCCAAGGGCGTGGTGCACGGCGACATCAAGGCGGACAATTGCCTGCTGCGGCTCGACTCGGGGGCGGCG
CCGGCCTCGTCGTGGAGGGCTGACGGCAGCAACGGCTGGGCGGGCCGCGGGCTGGTGCTCATTGACTTTGGGCGC
GCCATTGACATGCGGGCGTTTGCGCCACAAGTCGAGTTTGTCGCCGACTGGAAGACGGGCGCCAACGACTGCGCC
GAGATGCGCGAGGGCCGCCCCTGGACGTGGCAGATTGACTATTACGGCCTGGCCGGCACCCTGCACTGCCTCCTC
TTTGGCCGCTACATGGACACGCTGCGCTGCGACGACGGCGGCCTGGGACGCACCGGCCGCCGCTACCGCATCCGC
GACGCCCTCAAGCGCTACTGGCAGACGCAGCTGTGGGCCGACTGCTTCGACATGCTGCTCAACCCCGTGGCCCAT
GCCGCCGTCCCGGGCAACGAGGAGCGCGCCGCCATGCCGCTGCTGCTGTCCATGAGGCGTGTGCGGGAGCGCATG
GAGCGCTGGCTTGAGCAGAATTGCGAGAGGGGCCTTGGCCTGCGTGCTCTGCTTGCCAAGGTGGAGGCGCAGGCG
CGGAGCCGTAGGTAG
Gene >OphauB2|5568
ATGGCAGTTTCAGAAAAGACTGTCGATTTTGAGGCGATTGAGAGAGACAAGGAAAATATTCAGTCGCTGCCTGGC
GGACGGTCGGCCAAGAAGCTAGTGGAGCTCTACTCACAATCTCCGGTGCACAAAACATGGACACGGACAGCTGAA
GGCGACACAGGGCGGGTGAATGAATGCATACGGGCAGAGTACGAGGCCGAGGTGCAAAAGATTGGCGAATCGGAC
GATCCGCTCGACGTGTTTGACCGGTACGTGCAGTGGACGCTGGACGCGTATCCGTCGGCACAGGCGACAGCACAA
TCACAGCTTCACACATTGTTGGAGCGGGCAACCAAGGCATTTATTGGCTCGGCACAGTACAAGAACGACCTGCGC
TATCTGAAGCTATGGCTGCACTATATTCACTTTTTTGCCGACGCGCCGCGCGAGACGTATATATTTCTGTCGCGC
CATGGCATTGGACATAGCCTGGCGCTCTTTTACGAGGAATACGCCGCGTGGCTGGAGGGCGCGGGCAAGTTTTGC
CAGGCCGAAGAGGTGTACAGGGCAGGCATGGAGCGCGAGGCGCGACCGGTGCAGAGGCTGCAGCGCAAATTCAAA
GAGTTTGAGGCGAGGGCGGGCAGGCGAGCACAAGAGGATTTGGATGAAGCATCGTCGCCGGCACTGCCAACGGCT
CGCCCAGCTCTGGCCTCCAAGGCGGATCCCTTTGGCAGTGCTGCTGCGCCGGCGCCACAGCAGAGCCGTGCTGGC
AATAGTGCTTCGTCGCGGCCTGCCAAGTCCAAGATTGAAGTCTTTTGCGATGCCGACGCGCAGCCGTCTGCCCTG
GGCTCTCACGACGGAGCATCGCGGGGGTGGGAGACGATTGACTCTCTTGCGGCACGGAAAAAGGAGAATACAATA
GAGGCGAAGCCGTGGGTGGGACAGACGCTCAAGGCGGGAGGAAACAAGACGACGGCATCAGAGCTGATTGTCTTT
AGAGATGCGGTAAGTTTGCTCTCCATTCATCTCTTGCGTATCCGTATATTGATGGCAATAGGACTAATGTTGGGG
GCCTGCTTGGTGCCTTTATGTATTCTCAGTCTCAGTCTCAGTCTCAGTCTTTAGTAAACAAGGTGGCTGTTGTTC
CCTCCAAGAGCCAAATCTCGGTACATCCCCAGACGGGCAAGAAGGAGTGCGTCTTTGTCCACCTTGCAGTCATTT
ACCCCACGCCAGATGAAGCCGGCACTGAGCTGAGCTTTGAGGAGGTCATTGCCGCAAATCGCGGATGGCTTGACT
CTGACTGGAGCGAACAAGGCACCAAAGGGGAAAGCCTTGTCGGGGAGCCGGCCGGCCAAGTGCTCAACGAGGCTT
TTGTAGAGCCAAGGCAGGCTGCTTTGGCAGAGACTGTTGCTGCTGCTGCTGTTGATGAGGACAGAATAATGTACG
ATGAAAACGGCGCAGTCAAGCAAGAGCCTCGGGCACGGGCGGCAGGCCGAAAGAAGAAGATGATGGAGGTGAATG
AGACACAGATTAGTGAGTTTTTTGCAAATGGCTGGCTGGTGCCTGTTTACTTGTTGTCTGCTAACACGAGAGCAG
TCAAGGCCAAGCTGGACTCGCCATTGGGTCCCAAGCTGCGCAAAAAAAGCACGTCTGAAGCAACCATGACGATTC
ACACAAGGGCAGCCACGGACGACATTTACGATATTTTCAACGCGCCGCTCAAGGCAGAAGGAGAGCAGGGCCAAG
AGGAGGAGAGCGCGTTTGACGATTTCTACGAGACTGACGACGACTACACGGTTGACGGAACAAGCCGAGTCGTTG
TTGACGCTGGCGAGCAAGACACGACGGATGCAGAGAGCAACGGGACGAGTCGTTTTGTTGGCGACGGAGCCGACG
AGGAGCAACAAGACGACGCATCGCTGGATGGACCAAGCGTGAGCGCATGGTCAGACTTTTCGACTCTCAAGCACA
TTCCCAGCCTGGGGCGCGAGGACAAGGCGACGACGGCTGAAGACGGCGAGGAAGAGGCAGATGTGGACGATGCCA
GTGTCGACGCAGCAGCAGAGGAAACAAGCCATGGATTGACAGACCAAGACAGCCAGGAAGACGTCTTGGCGGAGC
AGGCTCCCAGGACGCGTACAATCTACATCCCGCTCCCGCCAGAAGATTGTGAGGTTCCGACTGGGCCGTATAAGG
ATGCGGCCGAGGCGGCCAACAATCGGCTGCCGTTTATGACGCCCATTACGGAGCGGACCGAGTACTCGATGGATG
TCGAGGCCGAGTTTAGAAAGCGGCAGTCCAAGACGCCGAGCAGAGAGGGGCTGGACCTGGGGTCGCTGGAGAGCC
GTCTGGTGGAGATTGTGGAGGAGCAAGCAGTTTTAAAGCCTGCCGTGGTGGAGGAGGAGGAGCAAGCAGTTTCAA
AGCTCGTCGTGGTGGAAGAAGAGGAGGAGCAAGCAGTTTCAAAGCCTGCCGTGGTGGAAGAGGAGGAGGAGCAAG
CAGTTTCAAAGCTCGTCGTGGTGGAAGAGGAGGAGGAGCAAGCAGCATCAAAGCCCGTCGTGGTGGAAGAGGAGC
AAGCAGTTTCAAAGCCCGTCGTGGTGGAAGAAGAGGAGCAAGCAGCATCAAAGCCCGTCGTGGTAAAGGAGCAAG
CGCCGCTCTCCAGGCGTGCCTTGGCGCAAAGCAAGCCAGCCAAGGGACCCATCGTTACCGAAAAGCAGTGCAACC
CCGTCGACGACGGCATCCGGCAGGAAATCTTGAGCAAGACGCATCCGCCGCTGGCCTCGTGCGCGGGCTTCTTTG
ACCACAGGCCGGGCAAACATGAAGGCGGGGCCGAGATTCGGCGCTTTGCCAAGGCCATGGCCAGGGCCAGCAAGG
GCGGGGACAAGACGCCGGCAGAGATAGCGGTTGGGTTTGAGGATTCGGCAACGACGTGGAGGGTCAAGCGGGAGA
TTGGCGCCGGGGCGTATGCACCCGTCTATCTGGTGGAGCGGCAGGGCGAGGACGAGGCGGACACGGGCACGGAGG
GCGGGGTGTGCAGCAGCAGGCGGGGGCGGCTCGAGGCGCTCAAGATGGAGCAGCCGCCGACGGCATGGGAGTTTC
ACATGATGAGGCTGGCGCAGGCGCGGCTGGGGGCCCAGGACCGGGCAACGGCATCGCTGTCGGTGGCGCACGAGC
TGCACCTGTACGACAACGAGGGCTTCCTGCTGCTGCCCTACTATGCGCACGGGACGCTGCTCGATGTGGTCAATG
GCTTCCGGGCCGAGGCGGGGGGAGCCATGGACGAGGTGCTGGCCATGTGGCTGGCGGTAGAGCTGCTGCGGACCG
TCGAGGCGCTGCATGCCAAGGGCGTGGTGCACGGCGACATCAAGGCGGACAATTGCCTGCTGCGGCTCGACTCGG
GGGCGGCGCCGGCCTCGTCGTGGAGGGCTGACGGCAGCAACGGCTGGGCGGGCCGCGGGCTGGTGCTCATTGACT
TTGGGCGCGCCATTGACATGCGGGCGTTTGCGCCACAAGTCGAGTTTGTCGCCGACTGGAAGACGGGCGCCAACG
ACTGCGCCGAGATGCGCGAGGGCCGCCCCTGGACGTGGCAGATTGACTATTACGGCCTGGCCGGCACCCTGCACT
GCCTCCTCTTTGGCCGCTACATGGACACGCTGCGCTGCGACGACGGCGGCCTGGGACGCACCGGCCGCCGCTACC
GCATCCGCGACGCCCTCAAGCGCTACTGGCAGACGCAGCTGTGGGCCGACTGCTTCGACATGCTGCTCAACCCCG
TGGCCCATGCCGCCGTCCCGGGCAACGAGGAGCGCGCCGCCATGCCGCTGCTGCTGTCCATGAGGCGTGTGCGGG
AGCGCATGGAGCGCTGGCTTGAGCAGAATTGCGAGAGGGGCCTTGGCCTGCGTGCTCTGCTTGCCAAGGTGGAGG
CGCAGGCGCGGAGCCGTAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail