Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5566
Gene name
LocationContig_44:36001..37508
Strand+
Gene length (bp)1507
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03982 DAGAT Diacylglycerol acyltransferase 1.5E-91 156 445

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UY2|DGT2A_UMBRA Diacylglycerol O-acyltransferase 2A OS=Umbelopsis ramanniana GN=DGAT2A PE=1 SV=1 118 454 5.0E-99
sp|Q96UY1|DGT2B_UMBRA Diacylglycerol O-acyltransferase 2B OS=Umbelopsis ramanniana GN=DGAT2B PE=1 SV=1 117 455 1.0E-86
sp|O74850|DGAT2_SCHPO Diacylglycerol O-acyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dga1 PE=1 SV=3 130 455 2.0E-83
sp|Q54GC1|DGAT2_DICDI Diacylglycerol O-acyltransferase 2 OS=Dictyostelium discoideum GN=dgat2 PE=3 SV=1 117 453 2.0E-79
sp|Q2KHS5|MOG2A_XENLA 2-acylglycerol O-acyltransferase 2-A OS=Xenopus laevis GN=mogat2-a PE=2 SV=1 117 444 1.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UY2|DGT2A_UMBRA Diacylglycerol O-acyltransferase 2A OS=Umbelopsis ramanniana GN=DGAT2A PE=1 SV=1 118 454 5.0E-99
sp|Q96UY1|DGT2B_UMBRA Diacylglycerol O-acyltransferase 2B OS=Umbelopsis ramanniana GN=DGAT2B PE=1 SV=1 117 455 1.0E-86
sp|O74850|DGAT2_SCHPO Diacylglycerol O-acyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dga1 PE=1 SV=3 130 455 2.0E-83
sp|Q54GC1|DGAT2_DICDI Diacylglycerol O-acyltransferase 2 OS=Dictyostelium discoideum GN=dgat2 PE=3 SV=1 117 453 2.0E-79
sp|Q2KHS5|MOG2A_XENLA 2-acylglycerol O-acyltransferase 2-A OS=Xenopus laevis GN=mogat2-a PE=2 SV=1 117 444 1.0E-77
sp|Q70VZ7|MOGT1_BOVIN 2-acylglycerol O-acyltransferase 1 OS=Bos taurus GN=MOGAT1 PE=2 SV=1 117 450 4.0E-77
sp|Q80W94|MOGT2_MOUSE 2-acylglycerol O-acyltransferase 2 OS=Mus musculus GN=Mogat2 PE=1 SV=1 117 452 8.0E-76
sp|Q28C88|MOGT1_XENTR 2-acylglycerol O-acyltransferase 1 OS=Xenopus tropicalis GN=mogat1 PE=2 SV=1 117 439 1.0E-75
sp|Q3SYC2|MOGT2_HUMAN 2-acylglycerol O-acyltransferase 2 OS=Homo sapiens GN=MOGAT2 PE=1 SV=2 117 444 3.0E-75
sp|Q75BY0|DGAT2_ASHGO Diacylglycerol O-acyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DGA1 PE=3 SV=1 120 454 7.0E-75
sp|Q96PD6|MOGT1_HUMAN 2-acylglycerol O-acyltransferase 1 OS=Homo sapiens GN=MOGAT1 PE=2 SV=2 117 450 3.0E-73
sp|Q3KPP4|MOGT1_XENLA 2-acylglycerol O-acyltransferase 1 OS=Xenopus laevis GN=mogat1 PE=2 SV=1 117 439 8.0E-73
sp|Q08650|DGAT2_YEAST Diacylglycerol O-acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DGA1 PE=1 SV=1 85 436 2.0E-72
sp|Q5M8H5|MOGT2_XENTR 2-acylglycerol O-acyltransferase 2 OS=Xenopus tropicalis GN=mogat2 PE=2 SV=1 117 450 4.0E-72
sp|Q5M7F4|MOG2B_XENLA 2-acylglycerol O-acyltransferase 2-B OS=Xenopus laevis GN=mogat2-b PE=2 SV=1 117 439 2.0E-70
sp|Q91ZV4|MOGT1_MOUSE 2-acylglycerol O-acyltransferase 1 OS=Mus musculus GN=Mogat1 PE=1 SV=2 117 450 2.0E-70
sp|Q4V9F0|DGAT2_DANRE Diacylglycerol O-acyltransferase 2 OS=Danio rerio GN=dgat2 PE=2 SV=1 130 443 4.0E-70
sp|Q96PD7|DGAT2_HUMAN Diacylglycerol O-acyltransferase 2 OS=Homo sapiens GN=DGAT2 PE=1 SV=2 126 454 4.0E-69
sp|Q5FVP8|DGAT2_RAT Diacylglycerol O-acyltransferase 2 OS=Rattus norvegicus GN=Dgat2 PE=2 SV=1 126 454 2.0E-68
sp|Q9DCV3|DGAT2_MOUSE Diacylglycerol O-acyltransferase 2 OS=Mus musculus GN=Dgat2 PE=1 SV=1 126 454 2.0E-68
sp|Q70VZ8|DGAT2_BOVIN Diacylglycerol O-acyltransferase 2 OS=Bos taurus GN=DGAT2 PE=2 SV=1 126 454 4.0E-68
sp|Q6P342|DGAT2_XENTR Diacylglycerol O-acyltransferase 2 OS=Xenopus tropicalis GN=dgat2 PE=2 SV=1 135 454 1.0E-65
sp|Q6PAZ3|DGAT2_XENLA Diacylglycerol O-acyltransferase 2 OS=Xenopus laevis GN=dgat2 PE=2 SV=1 135 439 5.0E-64
sp|Q86VF5|MOGT3_HUMAN 2-acylglycerol O-acyltransferase 3 OS=Homo sapiens GN=MOGAT3 PE=1 SV=1 127 441 9.0E-63
sp|A2ADU8|DG2L6_MOUSE Diacylglycerol O-acyltransferase 2-like protein 6 OS=Mus musculus GN=Dgat2l6 PE=3 SV=1 135 454 2.0E-62
sp|Q6E213|AWAT2_HUMAN Acyl-CoA wax alcohol acyltransferase 2 OS=Homo sapiens GN=AWAT2 PE=1 SV=1 121 454 2.0E-62
sp|A6QP72|DG2L6_BOVIN Diacylglycerol O-acyltransferase 2-like protein 6 OS=Bos taurus GN=DGAT2L6 PE=2 SV=1 144 454 2.0E-60
sp|Q6E1M8|AWAT2_MOUSE Acyl-CoA wax alcohol acyltransferase 2 OS=Mus musculus GN=Awat2 PE=2 SV=1 119 454 3.0E-60
sp|Q6ZPD8|DG2L6_HUMAN Diacylglycerol O-acyltransferase 2-like protein 6 OS=Homo sapiens GN=DGAT2L6 PE=2 SV=1 144 453 1.0E-59
sp|A2ADU9|AWAT1_MOUSE Acyl-CoA wax alcohol acyltransferase 1 OS=Mus musculus GN=Awat1 PE=2 SV=1 146 451 5.0E-57
sp|Q58HT5|AWAT1_HUMAN Acyl-CoA wax alcohol acyltransferase 1 OS=Homo sapiens GN=AWAT1 PE=1 SV=1 151 451 1.0E-56
sp|Q9ASU1|DGAT2_ARATH Diacylglycerol O-acyltransferase 2 OS=Arabidopsis thaliana GN=DGAT2 PE=2 SV=1 197 437 1.0E-20
sp|Q6IED9|DG2L7_HUMAN Putative diacylglycerol O-acyltransferase 2-like protein DGAT2L7P OS=Homo sapiens GN=DGAT2L7P PE=5 SV=2 204 443 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0008374 O-acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 132 154 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5566
MASSSPKPNVDEKGQAESIRLRQLSHGSSEDTLLAPEGELKRAAPDDDAVAKTQASNFAVAVQGYKKLQDGQSLL
AETQAVGLKRRKTSKDGSSYPKLPSEHSRQQHEREAWRAGGIRFAPIKMPLKRRLQTAAVFLHCMSIGMLVSLFW
FTCANPLTWPILLVYLLHLSMSTAATDGKLRYRSEWLRSLPLWRLFAGYYPMRLHKTHELPPNRRYILGYHPHGI
ISHGAWCAFATNALGFGQKFPGITNSLLTLDSNFRLPFYRDWILAMGIRSVSKESIRNILSHGGPGNDGLGRAVT
IVIGGARESLEAQPGSLRLILRGRKGFIKMALRTGADLVPVIGFGENDLYDQLGPGSHPVVRKVQMFVLKAFKFT
IPALHGRGLLNYDVGLMPYRRQVNIVVGKPIRVEGSLGPQPSQEEIDRYHDLYIEEVERLYEAYSCQFSNGKVPE
LQIIA*
Coding >OphauB2|5566
ATGGCGAGCTCGTCACCCAAGCCGAATGTGGATGAAAAGGGACAGGCCGAGTCCATCAGGCTTCGGCAGCTCTCG
CACGGCAGCAGCGAAGATACGCTTCTAGCGCCCGAAGGAGAGCTCAAGAGGGCTGCTCCCGATGACGACGCCGTG
GCAAAGACACAAGCCAGCAATTTTGCCGTTGCAGTTCAAGGCTACAAGAAGCTGCAAGACGGGCAAAGTCTCTTG
GCAGAGACTCAAGCAGTAGGCCTCAAGAGACGCAAGACGTCCAAGGATGGCTCGTCGTATCCCAAACTGCCAAGC
GAGCATTCGCGACAGCAGCATGAAAGGGAGGCGTGGCGCGCAGGAGGCATCCGCTTTGCGCCCATCAAGATGCCA
CTCAAGCGCCGCCTGCAGACGGCAGCCGTCTTCTTGCACTGCATGTCAATTGGCATGCTGGTGTCGCTCTTTTGG
TTCACTTGCGCCAATCCGCTGACGTGGCCGATATTGCTTGTCTACCTGCTTCACCTGTCCATGTCAACGGCTGCG
ACTGACGGCAAGCTGCGCTATCGGTCCGAGTGGCTTCGAAGCCTGCCACTATGGAGGCTATTTGCCGGCTATTAT
CCCATGCGACTTCACAAGACACACGAGCTGCCTCCCAATAGGCGGTACATACTCGGCTACCATCCTCATGGCATA
ATTTCCCACGGTGCATGGTGTGCTTTTGCAACAAACGCTCTCGGCTTTGGGCAAAAATTTCCCGGCATCACCAAT
AGCTTGCTGACACTCGACTCCAACTTTCGCCTGCCCTTTTACCGCGACTGGATCCTGGCCATGGGCATTCGATCT
GTGTCCAAGGAGTCGATCCGCAACATCTTGTCTCATGGCGGCCCTGGCAACGATGGCCTGGGCCGTGCCGTGACC
ATTGTGATTGGTGGTGCCCGCGAGTCCTTGGAAGCGCAGCCTGGGTCGCTGCGGCTGATTTTGCGCGGGCGCAAA
GGCTTCATCAAGATGGCGCTTCGCACGGGTGCTGACCTGGTGCCTGTCATTGGCTTTGGCGAAAATGACTTGTAC
GATCAACTCGGTCCAGGCTCGCATCCAGTGGTGCGCAAAGTGCAAATGTTTGTGCTCAAGGCCTTTAAGTTTACC
ATTCCCGCTCTACACGGTCGGGGTCTGCTCAACTACGACGTTGGCTTGATGCCATATCGCCGGCAAGTCAACATT
GTCGTGGGTAAGCCGATTCGAGTCGAGGGCTCGCTTGGGCCGCAGCCTTCGCAAGAGGAGATTGACCGGTACCAC
GATCTCTACATTGAAGAGGTGGAGCGACTTTATGAGGCATACAGCTGCCAATTCAGTAATGGCAAGGTGCCTGAG
CTGCAGATTATTGCCTAG
Transcript >OphauB2|5566
ATGGCGAGCTCGTCACCCAAGCCGAATGTGGATGAAAAGGGACAGGCCGAGTCCATCAGGCTTCGGCAGCTCTCG
CACGGCAGCAGCGAAGATACGCTTCTAGCGCCCGAAGGAGAGCTCAAGAGGGCTGCTCCCGATGACGACGCCGTG
GCAAAGACACAAGCCAGCAATTTTGCCGTTGCAGTTCAAGGCTACAAGAAGCTGCAAGACGGGCAAAGTCTCTTG
GCAGAGACTCAAGCAGTAGGCCTCAAGAGACGCAAGACGTCCAAGGATGGCTCGTCGTATCCCAAACTGCCAAGC
GAGCATTCGCGACAGCAGCATGAAAGGGAGGCGTGGCGCGCAGGAGGCATCCGCTTTGCGCCCATCAAGATGCCA
CTCAAGCGCCGCCTGCAGACGGCAGCCGTCTTCTTGCACTGCATGTCAATTGGCATGCTGGTGTCGCTCTTTTGG
TTCACTTGCGCCAATCCGCTGACGTGGCCGATATTGCTTGTCTACCTGCTTCACCTGTCCATGTCAACGGCTGCG
ACTGACGGCAAGCTGCGCTATCGGTCCGAGTGGCTTCGAAGCCTGCCACTATGGAGGCTATTTGCCGGCTATTAT
CCCATGCGACTTCACAAGACACACGAGCTGCCTCCCAATAGGCGGTACATACTCGGCTACCATCCTCATGGCATA
ATTTCCCACGGTGCATGGTGTGCTTTTGCAACAAACGCTCTCGGCTTTGGGCAAAAATTTCCCGGCATCACCAAT
AGCTTGCTGACACTCGACTCCAACTTTCGCCTGCCCTTTTACCGCGACTGGATCCTGGCCATGGGCATTCGATCT
GTGTCCAAGGAGTCGATCCGCAACATCTTGTCTCATGGCGGCCCTGGCAACGATGGCCTGGGCCGTGCCGTGACC
ATTGTGATTGGTGGTGCCCGCGAGTCCTTGGAAGCGCAGCCTGGGTCGCTGCGGCTGATTTTGCGCGGGCGCAAA
GGCTTCATCAAGATGGCGCTTCGCACGGGTGCTGACCTGGTGCCTGTCATTGGCTTTGGCGAAAATGACTTGTAC
GATCAACTCGGTCCAGGCTCGCATCCAGTGGTGCGCAAAGTGCAAATGTTTGTGCTCAAGGCCTTTAAGTTTACC
ATTCCCGCTCTACACGGTCGGGGTCTGCTCAACTACGACGTTGGCTTGATGCCATATCGCCGGCAAGTCAACATT
GTCGTGGGTAAGCCGATTCGAGTCGAGGGCTCGCTTGGGCCGCAGCCTTCGCAAGAGGAGATTGACCGGTACCAC
GATCTCTACATTGAAGAGGTGGAGCGACTTTATGAGGCATACAGCTGCCAATTCAGTAATGGCAAGGTGCCTGAG
CTGCAGATTATTGCCTAG
Gene >OphauB2|5566
ATGGCGAGCTCGTCACCCAAGCCGAGTAAGATGGGCTTACGCAACAAGAATCGTCGCAAGGACAAGGTGCCGAAT
CCAGTTTCTGACGCTGCAGACGCAGATGTGGATGAAAAGGGACAGGCCGAGTCCATCAGGCTTCGGCAGCTCTCG
CACGGCAGCAGCGAAGATACGCTTCTAGCGGTACGTCGCTCGCATGGGCCGCTTGACTTGCTGGGAGCTGATTGT
GCCTCATACGGACTCTCAGCCCGAAGGAGAGCTCAAGAGGGCTGCTCCCGATGACGACGCCGTGGCAAAGACACA
AGCCAGCAATTTTGCCGTTGCAGTTCAAGGCTACAAGAAGCTGCAAGACGGGCAAAGTCTCTTGGCAGAGACTCA
AGCAGTAGGCCTCAAGAGACGCAAGACGTCCAAGGATGGCTCGTCGTATCCCAAACTGCCAAGCGAGCATTCGCG
ACAGCAGCATGAAAGGGAGGCGTGGCGCGCAGGAGGCATCCGCTTTGCGCCCATCAAGATGCCACTCAAGCGCCG
CCTGCAGACGGCAGCCGTCTTCTTGCACTGCATGTCAATTGGCATGCTGGTGTCGCTCTTTTGGTTCACTTGCGC
CAATCCGCTGACGTGGCCGATATTGCTTGTCTACCTGCTTCACCTGTCCATGTCAACGGCTGCGACTGACGGCAA
GCTGCGCTATCGGTCCGAGTGGCTTCGAAGCCTGCCACTATGGAGGCTATTTGCCGGCTATTATCCCATGCGACT
TCACAAGACACACGAGCTGCCTCCCAATAGGCGGTACATACTCGGCTACCATCCTCATGGCATAATTTCCCACGG
TGCATGGTGTGCTTTTGCAACAAACGCTCTCGGCTTTGGGCAAAAATTTCCCGGCATCACCAATAGCTTGCTGAC
ACTCGACTCCAACTTTCGCCTGCCCTTTTACCGCGACTGGATCCTGGCCATGGGCATTCGATCTGTGTCCAAGGA
GTCGATCCGCAACATCTTGTCTCATGGCGGCCCTGGCAACGATGGCCTGGGCCGTGCCGTGACCATTGTGATTGG
TGGTGCCCGCGAGTCCTTGGAAGCGCAGCCTGGGTCGCTGCGGCTGATTTTGCGCGGGCGCAAAGGCTTCATCAA
GATGGCGCTTCGCACGGGTGCTGACCTGGTGCCTGTCATTGGCTTTGGCGAAAATGACTTGTACGATCAACTCGG
TCCAGGCTCGCATCCAGTGGTGCGCAAAGTGCAAATGTTTGTGCTCAAGGCCTTTAAGTTTACCATTCCCGCTCT
ACACGGTCGGGGTCTGCTCAACTACGACGTTGGCTTGATGCCATATCGCCGGCAAGTCAACATTGTCGTGGGTAA
GCCGATTCGAGTCGAGGGCTCGCTTGGGCCGCAGCCTTCGCAAGAGGAGATTGACCGGTACCACGATCTCTACAT
TGAAGAGGTGGAGCGACTTTATGAGGCATACAGCTGCCAATTCAGTAATGGCAAGGTGCCTGAGCTGCAGATTAT
TGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail