Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5556
Gene name
LocationContig_44:11898..12320
Strand+
Gene length (bp)422
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07019 EMC6 EMC6 1.0E-28 23 113

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59764|YJMB_SCHPO ER membrane protein complex subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.11c PE=3 SV=2 4 116 2.0E-19
sp|Q3ZCG8|EMC6_BOVIN ER membrane protein complex subunit 6 OS=Bos taurus GN=EMC6 PE=3 SV=1 12 116 3.0E-06
sp|Q68EU8|EMC6_XENLA ER membrane protein complex subunit 6 OS=Xenopus laevis GN=emc6 PE=3 SV=1 12 116 5.0E-06
sp|Q6GLC5|EMC6_XENTR ER membrane protein complex subunit 6 OS=Xenopus tropicalis GN=emc6 PE=3 SV=1 12 116 8.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 94 116 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5556
MTSERQFQIHPIVQDSVMHNSKTISNLHSLSASLFGVCAGILGLESYSGFLFYLLLSTFTSLLFYALKVAPESLA
EKRTLFDTGRYFHAALDFWTGGILGGLSGFVLTWTLFYGLVRA*
Coding >OphauB2|5556
ATGACTTCCGAACGTCAATTCCAGATACACCCAATTGTGCAGGACTCGGTCATGCACAATTCCAAGACCATTTCG
AATCTACACAGTCTCTCTGCCTCTCTCTTTGGAGTTTGTGCCGGTATCCTCGGCCTCGAATCTTATTCTGGCTTC
CTCTTTTATCTCCTTCTTTCCACCTTTACCAGTCTGCTCTTTTACGCTCTCAAAGTCGCTCCCGAATCACTTGCC
GAGAAACGAACCCTCTTTGACACGGGCCGGTATTTTCACGCCGCACTCGATTTCTGGACTGGCGGTATACTTGGT
GGACTCTCCGGCTTCGTTCTCACCTGGACCCTCTTTTACGGTCTTGTGAGGGCTTGA
Transcript >OphauB2|5556
ATGACTTCCGAACGTCAATTCCAGATACACCCAATTGTGCAGGACTCGGTCATGCACAATTCCAAGACCATTTCG
AATCTACACAGTCTCTCTGCCTCTCTCTTTGGAGTTTGTGCCGGTATCCTCGGCCTCGAATCTTATTCTGGCTTC
CTCTTTTATCTCCTTCTTTCCACCTTTACCAGTCTGCTCTTTTACGCTCTCAAAGTCGCTCCCGAATCACTTGCC
GAGAAACGAACCCTCTTTGACACGGGCCGGTATTTTCACGCCGCACTCGATTTCTGGACTGGCGGTATACTTGGT
GGACTCTCCGGCTTCGTTCTCACCTGGACCCTCTTTTACGGTCTTGTGAGGGCTTGA
Gene >OphauB2|5556
ATGACTTCCGAACGTCAATTCCAGATACACCCAATTGTGCAGGACTCGGTCATGCACAATTCCAAGGTGCGATCC
CATCGTGCCTACGCGTGGCCCAGTCGCGCCCACTTTGTTAACCTGATGCTCTCTAGACCATTTCGAATCTACACA
GTCTCTCTGCCTCTCTCTTTGGAGTTTGTGCCGGTATCCTCGGCCTCGAATCTTATTCTGGCTTCCTCTTTTATC
TCCTTCTTTCCACCTTTACCAGTCTGCTCTTTTACGCTCTCAAAGTCGCTCCCGAATCACTTGCCGAGAAACGAA
CCCTCTTTGACACGGGCCGGTATTTTCACGCCGCACTCGATTTCTGGACTGGCGGTATACTTGGTGGACTCTCCG
GCTTCGTTCTCACCTGGACCCTCTTTTACGGTCTTGTGAGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail