Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5547
Gene name
LocationContig_433:333..2525
Strand-
Gene length (bp)2192
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04433 SWIRM SWIRM domain 3.5E-32 134 219
PF16495 SWIRM-assoc_1 SWIRM-associated region 1 1.4E-28 561 642
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 3.1E-09 395 437
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 2.4E-05 396 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14470|SSR2_SCHPO SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr2 PE=1 SV=3 123 651 1.0E-93
sp|O13788|SSR1_SCHPO SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr1 PE=1 SV=1 111 636 4.0E-82
sp|P43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1 98 481 1.0E-77
sp|P32591|SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI3 PE=1 SV=1 127 638 1.0E-68
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 48 253 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14470|SSR2_SCHPO SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr2 PE=1 SV=3 123 651 1.0E-93
sp|O13788|SSR1_SCHPO SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr1 PE=1 SV=1 111 636 4.0E-82
sp|P43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1 98 481 1.0E-77
sp|P32591|SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI3 PE=1 SV=1 127 638 1.0E-68
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 48 253 2.0E-58
sp|Q6PDG5|SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2 48 253 2.0E-58
sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 48 250 4.0E-53
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2 48 250 5.0E-53
sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidopsis thaliana GN=SWI3C PE=1 SV=1 132 628 4.0E-51
sp|Q8W475|SWI3A_ARATH SWI/SNF complex subunit SWI3A OS=Arabidopsis thaliana GN=SWI3A PE=1 SV=1 133 630 3.0E-27
sp|Q54J55|MYBX_DICDI Myb-like protein X OS=Dictyostelium discoideum GN=mybX PE=3 SV=1 332 490 1.0E-17
sp|Q84JG2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidopsis thaliana GN=SWI3B PE=1 SV=1 130 227 1.0E-16
sp|Q84JG2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidopsis thaliana GN=SWI3B PE=1 SV=1 294 644 3.0E-16
sp|Q6PDG5|SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2 411 506 4.0E-16
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 411 506 4.0E-16
sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 411 506 3.0E-14
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2 411 506 3.0E-14
sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidopsis thaliana GN=SWI3D PE=1 SV=3 331 444 6.0E-11
sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 134 222 1.0E-10
sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidopsis thaliana GN=SWI3D PE=1 SV=3 132 220 1.0E-09
sp|Q69Z66|MYSM1_MOUSE Histone H2A deubiquitinase MYSM1 OS=Mus musculus GN=Mysm1 PE=1 SV=2 134 229 1.0E-08
sp|Q5VVJ2|MYSM1_HUMAN Histone H2A deubiquitinase MYSM1 OS=Homo sapiens GN=MYSM1 PE=1 SV=1 134 219 3.0E-08
sp|B6MUN4|MYSM1_BRAFL Histone H2A deubiquitinase MYSM1 OS=Branchiostoma floridae GN=MYSM1 PE=3 SV=1 129 226 2.0E-07
sp|Q6PDG5|SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2 577 632 7.0E-06
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 577 632 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5547
MTLWQTTVRRKTTRHQLGILYWHNRLYSLIRTRTTLKADVHMSETLPEETKDIKQDSTTPVPVAISDDRNNDPEE
PSTVDSTAHADKEMGDAPSTTDSKEASASNGQDVKSSKEATESKARDLLFKQRYSIVLPSYSTWFDMNTIHEIER
KAMAEFFNNRNRSKTPSVYKDYRDFMVNTYRLNPAEYLTVTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDADQ
RPSPNGPPWTGHFRIILDTPRGLQPWQPGSNDSIQQGKRNVDTDTKANAIATTKGDLNLEIGRNIYEANAKGTLI
SKPDKNSKKSNGETSGTNGLAGSDDVTARVNCYQCGSECGRVYFHSSQPDASSKAKHELCPLCFTQGRLPANHTS
GMYTKFENSSYEDSSDRAAPWTDAEILRLLEGLERFDEDWNQVAEYVGTRTREECVLQFLQLDIEDKYLTSEAPA
TGTGGLSLSLLGSQTGLVPFSSVDNPIMSVVGFLASLANPSSTAAAANKTAEELKRSLRKRLYGGKEASEAAPGQ
SVTHDALKSSDLMDVDGRQDKGDDGYDGNRPDLTTLPLAIVGARASAFASYEEREMTRLVSAATNVMLQKLELKL
RCFDEMEAALRVERRELERGRQQLFLDRLSFRRRVREVEDSVKAATAVGGEQVARFAHETAAREGEGLSLQPTIG
EAWGEQPTSNSAAIKSLEV*
Coding >OphauB2|5547
ATGACTCTATGGCAAACTACGGTTCGCCGGAAAACGACGCGTCACCAACTGGGAATCCTATATTGGCACAACCGC
CTCTACAGCCTGATACGAACTCGAACGACACTCAAGGCAGATGTACACATGTCCGAGACACTCCCGGAAGAGACG
AAGGACATTAAGCAGGACAGTACTACACCTGTTCCAGTTGCCATATCCGATGATCGAAACAATGACCCGGAAGAG
CCGTCGACTGTAGATTCGACTGCACATGCTGACAAGGAAATGGGCGATGCGCCTTCTACCACTGACTCCAAAGAA
GCCTCGGCATCCAATGGCCAGGACGTGAAGTCTTCAAAAGAGGCCACTGAGTCGAAGGCGCGCGATCTCCTCTTC
AAACAGAGGTATTCCATCGTCTTGCCCAGCTATAGCACGTGGTTCGACATGAATACTATTCATGAAATAGAGCGC
AAGGCCATGGCCGAATTCTTCAACAACCGCAACAGGAGCAAAACTCCATCTGTCTACAAGGACTATCGTGACTTC
ATGGTTAATACTTATCGACTTAACCCTGCCGAATATTTGACTGTAACGGCATGTCGACGCAACCTGGCTGGCGAT
GTATGTGCCATTATGCGCGTCCATGCTTTCCTCGAACAATGGGGCCTCATCAATTATCAGGTGGACGCTGATCAG
AGACCCTCTCCTAATGGCCCACCATGGACTGGGCACTTTCGAATCATCCTTGATACACCCCGCGGTCTTCAACCA
TGGCAGCCGGGATCGAATGATAGTATACAGCAGGGGAAGAGAAATGTCGACACGGATACCAAGGCCAACGCCATA
GCCACCACTAAGGGCGACCTGAACCTCGAGATTGGGCGTAACATTTACGAAGCTAACGCCAAGGGAACCTTAATT
TCAAAGCCAGACAAAAACAGTAAAAAATCCAACGGTGAAACATCAGGTACTAATGGCTTGGCTGGATCTGATGAT
GTGACGGCCAGAGTCAATTGCTACCAGTGTGGAAGCGAGTGTGGCCGTGTCTACTTTCATAGTAGCCAACCTGAT
GCGAGCTCAAAGGCAAAACACGAACTTTGCCCTCTTTGCTTTACCCAGGGCCGATTACCCGCCAACCATACTTCC
GGCATGTACACTAAGTTTGAAAATTCGAGTTACGAAGACAGCTCGGACCGCGCAGCGCCATGGACCGATGCCGAA
ATCCTTCGTTTGCTAGAGGGGCTCGAACGCTTCGATGAGGACTGGAATCAAGTAGCAGAATACGTGGGAACTCGA
ACTCGCGAAGAATGCGTTTTACAATTTCTCCAGCTCGATATAGAGGACAAGTATTTGACCTCGGAAGCTCCAGCT
ACCGGCACAGGAGGCCTATCGCTATCGCTTCTTGGATCTCAGACAGGTTTAGTGCCATTCAGCTCAGTCGACAAT
CCTATCATGTCTGTGGTGGGTTTTCTGGCCAGTCTTGCGAATCCAAGCAGTACCGCTGCCGCTGCGAATAAGACT
GCTGAAGAACTGAAGCGGAGTTTGCGCAAGAGGCTTTATGGAGGGAAAGAGGCAAGTGAGGCAGCTCCGGGGCAG
AGTGTCACGCATGATGCCTTGAAAAGCAGCGATTTGATGGACGTTGATGGACGTCAGGACAAGGGTGACGATGGC
TATGATGGTAACAGACCAGATTTAACGACGCTGCCCCTGGCAATTGTGGGAGCCCGAGCCTCTGCGTTTGCCTCA
TATGAAGAACGTGAGATGACACGTCTCGTATCGGCGGCAACCAATGTCATGTTGCAAAAACTGGAACTCAAGCTC
AGGTGTTTCGATGAGATGGAGGCAGCCTTACGAGTCGAACGTCGAGAATTAGAGCGTGGACGACAGCAGCTGTTC
CTAGACCGTCTATCATTCAGGCGCCGGGTACGCGAGGTGGAGGACAGTGTCAAGGCGGCGACAGCCGTCGGCGGA
GAGCAGGTAGCGCGATTTGCACACGAAACGGCAGCCAGAGAAGGGGAGGGGTTAAGTCTACAGCCGACTATAGGG
GAAGCATGGGGAGAGCAACCAACTAGCAATAGTGCAGCTATTAAGAGCCTTGAAGTATAA
Transcript >OphauB2|5547
ATGACTCTATGGCAAACTACGGTTCGCCGGAAAACGACGCGTCACCAACTGGGAATCCTATATTGGCACAACCGC
CTCTACAGCCTGATACGAACTCGAACGACACTCAAGGCAGATGTACACATGTCCGAGACACTCCCGGAAGAGACG
AAGGACATTAAGCAGGACAGTACTACACCTGTTCCAGTTGCCATATCCGATGATCGAAACAATGACCCGGAAGAG
CCGTCGACTGTAGATTCGACTGCACATGCTGACAAGGAAATGGGCGATGCGCCTTCTACCACTGACTCCAAAGAA
GCCTCGGCATCCAATGGCCAGGACGTGAAGTCTTCAAAAGAGGCCACTGAGTCGAAGGCGCGCGATCTCCTCTTC
AAACAGAGGTATTCCATCGTCTTGCCCAGCTATAGCACGTGGTTCGACATGAATACTATTCATGAAATAGAGCGC
AAGGCCATGGCCGAATTCTTCAACAACCGCAACAGGAGCAAAACTCCATCTGTCTACAAGGACTATCGTGACTTC
ATGGTTAATACTTATCGACTTAACCCTGCCGAATATTTGACTGTAACGGCATGTCGACGCAACCTGGCTGGCGAT
GTATGTGCCATTATGCGCGTCCATGCTTTCCTCGAACAATGGGGCCTCATCAATTATCAGGTGGACGCTGATCAG
AGACCCTCTCCTAATGGCCCACCATGGACTGGGCACTTTCGAATCATCCTTGATACACCCCGCGGTCTTCAACCA
TGGCAGCCGGGATCGAATGATAGTATACAGCAGGGGAAGAGAAATGTCGACACGGATACCAAGGCCAACGCCATA
GCCACCACTAAGGGCGACCTGAACCTCGAGATTGGGCGTAACATTTACGAAGCTAACGCCAAGGGAACCTTAATT
TCAAAGCCAGACAAAAACAGTAAAAAATCCAACGGTGAAACATCAGGTACTAATGGCTTGGCTGGATCTGATGAT
GTGACGGCCAGAGTCAATTGCTACCAGTGTGGAAGCGAGTGTGGCCGTGTCTACTTTCATAGTAGCCAACCTGAT
GCGAGCTCAAAGGCAAAACACGAACTTTGCCCTCTTTGCTTTACCCAGGGCCGATTACCCGCCAACCATACTTCC
GGCATGTACACTAAGTTTGAAAATTCGAGTTACGAAGACAGCTCGGACCGCGCAGCGCCATGGACCGATGCCGAA
ATCCTTCGTTTGCTAGAGGGGCTCGAACGCTTCGATGAGGACTGGAATCAAGTAGCAGAATACGTGGGAACTCGA
ACTCGCGAAGAATGCGTTTTACAATTTCTCCAGCTCGATATAGAGGACAAGTATTTGACCTCGGAAGCTCCAGCT
ACCGGCACAGGAGGCCTATCGCTATCGCTTCTTGGATCTCAGACAGGTTTAGTGCCATTCAGCTCAGTCGACAAT
CCTATCATGTCTGTGGTGGGTTTTCTGGCCAGTCTTGCGAATCCAAGCAGTACCGCTGCCGCTGCGAATAAGACT
GCTGAAGAACTGAAGCGGAGTTTGCGCAAGAGGCTTTATGGAGGGAAAGAGGCAAGTGAGGCAGCTCCGGGGCAG
AGTGTCACGCATGATGCCTTGAAAAGCAGCGATTTGATGGACGTTGATGGACGTCAGGACAAGGGTGACGATGGC
TATGATGGTAACAGACCAGATTTAACGACGCTGCCCCTGGCAATTGTGGGAGCCCGAGCCTCTGCGTTTGCCTCA
TATGAAGAACGTGAGATGACACGTCTCGTATCGGCGGCAACCAATGTCATGTTGCAAAAACTGGAACTCAAGCTC
AGGTGTTTCGATGAGATGGAGGCAGCCTTACGAGTCGAACGTCGAGAATTAGAGCGTGGACGACAGCAGCTGTTC
CTAGACCGTCTATCATTCAGGCGCCGGGTACGCGAGGTGGAGGACAGTGTCAAGGCGGCGACAGCCGTCGGCGGA
GAGCAGGTAGCGCGATTTGCACACGAAACGGCAGCCAGAGAAGGGGAGGGGTTAAGTCTACAGCCGACTATAGGG
GAAGCATGGGGAGAGCAACCAACTAGCAATAGTGCAGCTATTAAGAGCCTTGAAGTATAA
Gene >OphauB2|5547
ATGACTCTATGGCAAACTACGGTTCGCCGGAAAACGACGCGTCACCAACTGGGAATCCTATATTGGCACAACCGC
CTCTACAGCCTGATACGAACTCGAACGACACTCAAGGCAGGTTTCCATGGCTTTAATCGGCAACTATTTGCTAAT
TCCACACCATAGATGTACACATGTCCGAGACACTCCCGGAAGAGACGAAGGACATTAAGCAGGACAGTACTACAC
CTGTTCCAGTTGCCATATCCGATGATCGAAACAATGACCCGGAAGAGCCGTCGACTGTAGATTCGACTGCACATG
CTGACAAGGAAATGGGCGATGCGCCTTCTACCACTGACTCCAAAGAAGCCTCGGCATCCAATGGCCAGGACGTGA
AGTCTTCAAAAGAGGCCACTGAGTCGAAGGCGCGCGATCTCCTCTTCAAACAGAGGTATTCCATCGTCTTGCCCA
GCTATAGCACGTGGTTCGACATGAATACTATTCATGAAATAGAGCGCAAGGCCATGGCCGAATTCTTCAACAACC
GCAACAGGAGCAAAACTCCATCTGTCTACAAGGACTATCGTGACTTCATGGTTAATACTTATCGACTTAACCCTG
CCGAATATTTGACTGTAACGGCATGTCGACGCAACCTGGCTGGCGATGTATGTGCCATTATGCGCGTCCATGCTT
TCCTCGAACAATGGGGCCTCATCAATTATCAGGTAAGGTTCATCTTATGAACCCGCTAGATTTCAAGATACAGCT
GTTGACACTTTTCGCAGGTGGACGCTGATCAGAGACCCTCTCCTAATGGCCCACCATGGACTGGGCACTTTCGAA
TCATCCTTGATACACCCCGCGGTCTTCAACCATGGCAGCCGGGATCGAATGATAGTATACAGCAGGGGAAGAGAA
ATGTCGACACGGATACCAAGGCCAACGCCATAGCCACCACTAAGGGCGACCTGAACCTCGAGATTGGGCGTAACA
TTTACGAAGCTAACGCCAAGGGAACCTTAATTTCAAAGCCAGACAAAAACAGTAAAAAATCCAACGGTGAAACAT
CAGGTACTAATGGCTTGGCTGGATCTGATGATGTGACGGCCAGAGTCAATTGCTACCAGTGTGGAAGCGAGTGTG
GCCGTGTCTACTTTCATAGTAGCCAACCTGATGCGAGCTCAAAGGCAAAACACGAACTTTGCCCTCTTTGCTTTA
CCCAGGGCCGATTACCCGCCAACCATACTTCCGGCATGTACACTAAGTTTGAAAATTCGAGTTACGAAGACAGCT
CGGACCGCGCAGCGCCATGGACCGATGCCGAAATCCTTCGTTTGCTAGAGGGGCTCGAACGCTTCGATGAGGACT
GGAATCAAGTAGCAGAATACGTGGGAACTCGAACTCGCGAAGAATGCGTTTTACAATTTCTCCAGCTCGATATAG
AGGACAAGTATTTGACCTCGGAAGCTCCAGCTACCGGCACAGGAGGCCTATCGCTATCGCTTCTTGGATCTCAGA
CAGGTTTAGTGCCATTCAGCTCAGTCGACAATCCTATCATGTCTGTGGTGGGTTTTCTGGCCAGTCTTGCGAATC
CAAGCAGTACCGCTGCCGCTGCGAATAAGACTGCTGAAGAACTGAAGCGGAGTTTGCGCAAGAGGCTTTATGGAG
GGAAAGAGGCAAGTGAGGCAGCTCCGGGGCAGAGTGTCACGCATGATGCCTTGAAAAGCAGCGATTTGATGGACG
TTGATGGACGTCAGGACAAGGGTGACGATGGCTATGATGGTAACAGACCAGATTTAACGACGCTGCCCCTGGCAA
TTGTGGGAGCCCGAGCCTCTGCGTTTGCCTCATATGAAGAACGTGAGATGACACGTCTCGTATCGGCGGCAACCA
ATGTCATGTTGCAAAAACTGGAACTCAAGCTCAGGTGTTTCGATGAGATGGAGGCAGCCTTACGAGTCGAACGTC
GAGAATTAGAGCGTGGACGACAGCAGCTGTTCCTAGACCGTCTATCATTCAGGCGCCGGGTACGCGAGGTGGAGG
ACAGTGTCAAGGCGGCGACAGCCGTCGGCGGAGAGCAGGTAGCGCGATTTGCACACGAAACGGCAGCCAGAGAAG
GGGAGGGGTTAAGTCTACAGCCGACTATAGGGGAAGCATGGGGAGAGCAACCAACTAGCAATAGTGCAGCTATTA
AGAGCCTTGAAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail