Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5544
Gene name
LocationContig_430:273..2173
Strand-
Gene length (bp)1900
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06418 CTP_synth_N CTP synthase N-terminus 5.0E-94 1 221
PF00117 GATase Glutamine amidotransferase class-I 5.6E-54 264 501
PF07722 Peptidase_C26 Peptidase C26 1.2E-05 342 484

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZV2|PYRG_NEUCR CTP synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-7 PE=3 SV=2 1 516 0.0E+00
sp|O74638|PYRG_GIBZE CTP synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=URA7 PE=3 SV=2 1 523 0.0E+00
sp|O42644|PYRG_SCHPO CTP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura7 PE=3 SV=1 1 525 0.0E+00
sp|Q6FUD0|PYRG_CANGA CTP synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA7 PE=3 SV=1 1 525 0.0E+00
sp|P28274|URA7_YEAST CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA7 PE=1 SV=2 1 512 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZV2|PYRG_NEUCR CTP synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-7 PE=3 SV=2 1 516 0.0E+00
sp|O74638|PYRG_GIBZE CTP synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=URA7 PE=3 SV=2 1 523 0.0E+00
sp|O42644|PYRG_SCHPO CTP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura7 PE=3 SV=1 1 525 0.0E+00
sp|Q6FUD0|PYRG_CANGA CTP synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA7 PE=3 SV=1 1 525 0.0E+00
sp|P28274|URA7_YEAST CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA7 PE=1 SV=2 1 512 0.0E+00
sp|Q751L7|PYRG_ASHGO CTP synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA7 PE=3 SV=1 1 525 0.0E+00
sp|P38627|URA8_YEAST CTP synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA8 PE=1 SV=4 1 512 0.0E+00
sp|A6ZQ59|URA8_YEAS7 CTP synthase 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=URA8 PE=3 SV=1 1 512 0.0E+00
sp|Q7ZXP9|PYG1B_XENLA CTP synthase 1-B OS=Xenopus laevis GN=ctps1-b PE=2 SV=1 1 514 0.0E+00
sp|Q6GME1|PYRG2_XENLA CTP synthase 2 OS=Xenopus laevis GN=ctps2 PE=2 SV=1 1 514 0.0E+00
sp|Q6PEI7|PYRG1_DANRE CTP synthase 1 OS=Danio rerio GN=ctps1 PE=1 SV=1 1 514 0.0E+00
sp|Q5XHA8|PYG1A_XENLA CTP synthase 1-A OS=Xenopus laevis GN=ctps1-a PE=2 SV=1 1 514 0.0E+00
sp|P70698|PYRG1_MOUSE CTP synthase 1 OS=Mus musculus GN=Ctps1 PE=1 SV=2 1 514 0.0E+00
sp|P17812|PYRG1_HUMAN CTP synthase 1 OS=Homo sapiens GN=CTPS1 PE=1 SV=2 1 514 0.0E+00
sp|Q5F3Z1|PYRG2_CHICK CTP synthase 2 OS=Gallus gallus GN=CTPS2 PE=2 SV=1 1 514 0.0E+00
sp|Q1RMS2|PYRG2_BOVIN CTP synthase 2 OS=Bos taurus GN=CTPS2 PE=2 SV=1 1 520 0.0E+00
sp|Q9NRF8|PYRG2_HUMAN CTP synthase 2 OS=Homo sapiens GN=CTPS2 PE=1 SV=1 1 520 0.0E+00
sp|P70303|PYRG2_MOUSE CTP synthase 2 OS=Mus musculus GN=Ctps2 PE=1 SV=1 1 513 0.0E+00
sp|Q5U2N0|PYRG2_RAT CTP synthase 2 OS=Rattus norvegicus GN=Ctps2 PE=1 SV=1 1 513 0.0E+00
sp|Q2M197|PYRG_DROPS CTP synthase OS=Drosophila pseudoobscura pseudoobscura GN=CTPsyn PE=3 SV=2 1 512 3.0E-177
sp|Q9VUL1|PYRG_DROME CTP synthase OS=Drosophila melanogaster GN=CTPsyn PE=1 SV=2 1 512 2.0E-176
sp|Q54V77|PYRG_DICDI CTP synthase OS=Dictyostelium discoideum GN=ctps PE=3 SV=1 1 510 1.0E-175
sp|P50547|PYRG1_CRIGR CTP synthase 1 (Fragment) OS=Cricetulus griseus GN=CTPS1 PE=2 SV=1 1 442 2.0E-160
sp|Q3IS15|PYRG_NATPD CTP synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pyrG PE=3 SV=1 1 500 9.0E-155
sp|Q9HP32|PYRG_HALSA CTP synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pyrG PE=3 SV=1 1 502 2.0E-153
sp|B0R6G2|PYRG_HALS3 CTP synthase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pyrG PE=3 SV=1 1 502 2.0E-153
sp|O29987|PYRG_ARCFU CTP synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pyrG PE=3 SV=1 1 503 1.0E-152
sp|Q8TYT7|PYRG_METKA CTP synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pyrG PE=3 SV=1 1 505 1.0E-151
sp|Q3AFT7|PYRG_CARHZ CTP synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pyrG PE=3 SV=1 1 499 6.0E-151
sp|Q18FG3|PYRG_HALWD CTP synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pyrG PE=3 SV=1 1 508 6.0E-149
sp|A2SSJ7|PYRG_METLZ CTP synthase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pyrG PE=3 SV=1 1 502 7.0E-146
sp|Q12WH5|PYRG_METBU CTP synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pyrG PE=3 SV=1 1 502 9.0E-146
sp|Q5UX57|PYRG_HALMA CTP synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pyrG PE=3 SV=1 1 505 2.0E-145
sp|Q8DKT7|PYRG_THEEB CTP synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=pyrG PE=3 SV=1 1 509 2.0E-145
sp|Q6LYU4|PYRG_METMP CTP synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=pyrG PE=3 SV=1 1 503 2.0E-145
sp|Q6L1K7|PYRG_PICTO CTP synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pyrG PE=3 SV=1 1 503 4.0E-145
sp|Q1AW18|PYRG_RUBXD CTP synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pyrG PE=3 SV=1 1 514 4.0E-145
sp|C5A7F1|PYRG_THEGJ CTP synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pyrG PE=3 SV=1 1 503 9.0E-145
sp|A0B7H6|PYRG_METTP CTP synthase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pyrG PE=3 SV=1 1 502 5.0E-144
sp|A3CWS5|PYRG_METMJ CTP synthase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pyrG PE=3 SV=1 1 502 6.0E-144
sp|Q8R720|PYRG_CALS4 CTP synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pyrG PE=3 SV=1 1 502 7.0E-144
sp|B9L7R9|PYRG_NAUPA CTP synthase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=pyrG PE=3 SV=1 1 506 1.0E-143
sp|Q5JGF1|PYRG_THEKO CTP synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pyrG PE=3 SV=1 1 503 7.0E-143
sp|A7NN90|PYRG_ROSCS CTP synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pyrG PE=3 SV=1 1 521 4.0E-142
sp|B6YTF0|PYRG_THEON CTP synthase OS=Thermococcus onnurineus (strain NA1) GN=pyrG PE=3 SV=1 1 503 5.0E-142
sp|Q1IKC9|PYRG_KORVE CTP synthase OS=Koribacter versatilis (strain Ellin345) GN=pyrG PE=3 SV=1 1 503 7.0E-142
sp|A7IA93|PYRG_METB6 CTP synthase OS=Methanoregula boonei (strain 6A8) GN=pyrG PE=3 SV=1 1 502 1.0E-141
sp|A5UXX5|PYRG_ROSS1 CTP synthase OS=Roseiflexus sp. (strain RS-1) GN=pyrG PE=3 SV=1 1 524 2.0E-141
sp|B0CBC7|PYRG_ACAM1 CTP synthase OS=Acaryochloris marina (strain MBIC 11017) GN=pyrG PE=3 SV=1 1 507 4.0E-141
sp|A3DGR3|PYRG_CLOTH CTP synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=pyrG PE=3 SV=1 1 513 5.0E-141
sp|Q2RFU8|PYRG_MOOTA CTP synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=pyrG PE=3 SV=1 1 503 5.0E-141
sp|B7JVR6|PYRG_CYAP8 CTP synthase OS=Cyanothece sp. (strain PCC 8801) GN=pyrG PE=3 SV=1 1 503 5.0E-141
sp|O59456|PYRG_PYRHO CTP synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pyrG PE=3 SV=2 1 503 1.0E-140
sp|Q24MK9|PYRG_DESHY CTP synthase OS=Desulfitobacterium hafniense (strain Y51) GN=pyrG PE=3 SV=1 1 503 2.0E-140
sp|B9LB79|PYRG_CHLSY CTP synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pyrG PE=3 SV=1 1 507 3.0E-140
sp|A9WJ75|PYRG_CHLAA CTP synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pyrG PE=3 SV=1 1 507 3.0E-140
sp|Q5N040|PYRG_SYNP6 CTP synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=pyrG PE=3 SV=2 1 505 1.0E-139
sp|B5Y8A3|PYRG_COPPD CTP synthase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=pyrG PE=3 SV=1 1 503 1.0E-139
sp|Q8TZY6|PYRG_PYRFU CTP synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pyrG PE=3 SV=2 1 503 1.0E-139
sp|Q2JUH1|PYRG_SYNJA CTP synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=pyrG PE=3 SV=1 1 521 1.0E-139
sp|Q9V1S2|PYRG_PYRAB CTP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pyrG PE=3 SV=1 1 503 2.0E-139
sp|Q54775|PYRG_SYNE7 CTP synthase OS=Synechococcus elongatus (strain PCC 7942) GN=pyrG PE=3 SV=1 1 505 4.0E-139
sp|A6UTE4|PYRG_META3 CTP synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pyrG PE=3 SV=1 1 509 4.0E-139
sp|B8GAQ5|PYRG_CHLAD CTP synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pyrG PE=3 SV=1 1 507 1.0E-138
sp|B1XMC5|PYRG_SYNP2 CTP synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=pyrG PE=3 SV=1 1 524 2.0E-138
sp|C1F1E7|PYRG_ACIC5 CTP synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=pyrG PE=3 SV=1 1 503 2.0E-138
sp|Q8YMD4|PYRG_NOSS1 CTP synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pyrG PE=3 SV=1 1 503 3.0E-138
sp|Q3MAV1|PYRG_ANAVT CTP synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pyrG PE=3 SV=1 1 503 3.0E-138
sp|B8I598|PYRG_CLOCE CTP synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pyrG PE=3 SV=1 1 503 3.0E-138
sp|Q67TG8|PYRG_SYMTH CTP synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pyrG PE=3 SV=1 1 503 4.0E-138
sp|B7KF08|PYRG_CYAP7 CTP synthase OS=Cyanothece sp. (strain PCC 7424) GN=pyrG PE=3 SV=1 1 519 6.0E-138
sp|Q5KUG2|PYRG_GEOKA CTP synthase OS=Geobacillus kaustophilus (strain HTA426) GN=pyrG PE=3 SV=1 1 503 8.0E-138
sp|Q7NKF4|PYRG_GLOVI CTP synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=pyrG PE=3 SV=1 1 503 3.0E-137
sp|Q5WXA8|PYRG_LEGPL CTP synthase OS=Legionella pneumophila (strain Lens) GN=pyrG PE=3 SV=1 1 503 4.0E-137
sp|Q927T4|PYRG_LISIN CTP synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pyrG PE=3 SV=1 1 503 4.0E-137
sp|Q2FSE6|PYRG_METHJ CTP synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pyrG PE=3 SV=1 1 502 5.0E-137
sp|B8GIB3|PYRG_METPE CTP synthase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pyrG PE=3 SV=1 1 502 6.0E-137
sp|Q2LRK2|PYRG_SYNAS CTP synthase OS=Syntrophus aciditrophicus (strain SB) GN=pyrG PE=3 SV=1 1 503 6.0E-137
sp|Q71WM0|PYRG_LISMF CTP synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pyrG PE=3 SV=1 1 503 6.0E-137
sp|Q086B1|PYRG_SHEFN CTP synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pyrG PE=3 SV=1 1 503 8.0E-137
sp|Q9HM27|PYRG_THEAC CTP synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pyrG PE=3 SV=2 1 503 2.0E-136
sp|A5CYA0|PYRG_PELTS CTP synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pyrG PE=3 SV=1 1 503 3.0E-136
sp|Q8Y495|PYRG_LISMO CTP synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pyrG PE=3 SV=1 1 503 3.0E-136
sp|A1S4D6|PYRG_SHEAM CTP synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pyrG PE=3 SV=1 1 503 4.0E-136
sp|Q5ZWA4|PYRG_LEGPH CTP synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pyrG PE=3 SV=1 1 503 4.0E-136
sp|A5IB79|PYRG_LEGPC CTP synthase OS=Legionella pneumophila (strain Corby) GN=pyrG PE=3 SV=1 1 503 4.0E-136
sp|Q5X5Y6|PYRG_LEGPA CTP synthase OS=Legionella pneumophila (strain Paris) GN=pyrG PE=3 SV=1 1 503 4.0E-136
sp|B9L1H7|PYRG_THERP CTP synthase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=pyrG PE=3 SV=1 1 501 5.0E-136
sp|Q0APT7|PYRG_MARMM CTP synthase OS=Maricaulis maris (strain MCS10) GN=pyrG PE=3 SV=1 1 503 6.0E-136
sp|Q1WV30|PYRG_LACS1 CTP synthase OS=Lactobacillus salivarius (strain UCC118) GN=pyrG PE=3 SV=1 1 505 8.0E-136
sp|Q65DT7|PYRG_BACLD CTP synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pyrG PE=3 SV=1 1 503 8.0E-136
sp|Q2RT58|PYRG_RHORT CTP synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pyrG PE=3 SV=1 1 515 1.0E-135
sp|B1WV74|PYRG_CYAA5 CTP synthase OS=Cyanothece sp. (strain ATCC 51142) GN=pyrG PE=3 SV=1 1 503 1.0E-135
sp|B8IZF5|PYRG_DESDA CTP synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pyrG PE=3 SV=1 1 503 1.0E-135
sp|Q15QR7|PYRG_PSEA6 CTP synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pyrG PE=3 SV=1 1 504 1.0E-135
sp|B1JBP2|PYRG_PSEPW CTP synthase OS=Pseudomonas putida (strain W619) GN=pyrG PE=3 SV=1 1 503 2.0E-135
sp|Q9RU23|PYRG_DEIRA CTP synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pyrG PE=3 SV=1 1 503 2.0E-135
sp|A0KGH2|PYRG_AERHH CTP synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pyrG PE=3 SV=1 1 504 2.0E-135
sp|Q5SIA8|PYRG_THET8 CTP synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pyrG PE=1 SV=1 1 509 2.0E-135
sp|C4LBR2|PYRG_TOLAT CTP synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pyrG PE=3 SV=1 1 509 3.0E-135
sp|Q72IN0|PYRG_THET2 CTP synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pyrG PE=3 SV=1 1 509 3.0E-135
sp|Q97F61|PYRG_CLOAB CTP synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyrG PE=3 SV=1 1 499 4.0E-135
sp|A9B6S7|PYRG_HERA2 CTP synthase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pyrG PE=3 SV=1 1 503 5.0E-135
sp|B0TK03|PYRG_SHEHH CTP synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrG PE=3 SV=1 1 503 5.0E-135
sp|Q0AU97|PYRG_SYNWW CTP synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=pyrG PE=3 SV=1 1 508 6.0E-135
sp|Q58574|PYRG_METJA CTP synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pyrG PE=3 SV=1 1 505 6.0E-135
sp|A8FSS7|PYRG_SHESH CTP synthase OS=Shewanella sediminis (strain HAW-EB3) GN=pyrG PE=3 SV=1 1 509 7.0E-135
sp|Q0SQX5|PYRG_CLOPS CTP synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=pyrG PE=3 SV=1 1 503 8.0E-135
sp|Q8XIB3|PYRG_CLOPE CTP synthase OS=Clostridium perfringens (strain 13 / Type A) GN=pyrG PE=3 SV=1 1 503 8.0E-135
sp|Q0TNA4|PYRG_CLOP1 CTP synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pyrG PE=3 SV=1 1 503 8.0E-135
sp|A7H1B7|PYRG_CAMJD CTP synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=pyrG PE=3 SV=1 1 503 1.0E-134
sp|Q8TKW5|PYRG_METAC CTP synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pyrG PE=3 SV=1 1 502 2.0E-134
sp|A9BDD9|PYRG_PROM4 CTP synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=pyrG PE=3 SV=1 1 518 2.0E-134
sp|B6IQ27|PYRG_RHOCS CTP synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pyrG PE=3 SV=1 1 503 2.0E-134
sp|Q2SKX2|PYRG_HAHCH CTP synthase OS=Hahella chejuensis (strain KCTC 2396) GN=pyrG PE=3 SV=1 1 503 2.0E-134
sp|Q12PZ5|PYRG_SHEDO CTP synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pyrG PE=3 SV=1 1 510 2.0E-134
sp|A9IIP5|PYRG_BORPD CTP synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pyrG PE=3 SV=1 1 503 2.0E-134
sp|Q0HXH1|PYRG_SHESR CTP synthase OS=Shewanella sp. (strain MR-7) GN=pyrG PE=3 SV=1 1 504 2.0E-134
sp|A8H1S4|PYRG_SHEPA CTP synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pyrG PE=3 SV=1 1 509 2.0E-134
sp|B1KPT7|PYRG_SHEWM CTP synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pyrG PE=3 SV=1 1 500 2.0E-134
sp|B8E8T0|PYRG_SHEB2 CTP synthase OS=Shewanella baltica (strain OS223) GN=pyrG PE=3 SV=1 1 504 3.0E-134
sp|A9KYH1|PYRG_SHEB9 CTP synthase OS=Shewanella baltica (strain OS195) GN=pyrG PE=3 SV=1 1 504 3.0E-134
sp|A6WR29|PYRG_SHEB8 CTP synthase OS=Shewanella baltica (strain OS185) GN=pyrG PE=3 SV=1 1 504 3.0E-134
sp|A3D796|PYRG_SHEB5 CTP synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pyrG PE=3 SV=1 1 504 3.0E-134
sp|B8HNM9|PYRG_CYAP4 CTP synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=pyrG PE=3 SV=1 1 503 4.0E-134
sp|A8FJJ0|PYRG_CAMJ8 CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=pyrG PE=3 SV=1 1 503 4.0E-134
sp|B3R496|PYRG_CUPTR CTP synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=pyrG PE=3 SV=1 1 509 4.0E-134
sp|A3QC76|PYRG_SHELP CTP synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pyrG PE=3 SV=1 1 509 4.0E-134
sp|P13242|PYRG_BACSU CTP synthase OS=Bacillus subtilis (strain 168) GN=pyrG PE=3 SV=1 1 503 6.0E-134
sp|A1RHF2|PYRG_SHESW CTP synthase OS=Shewanella sp. (strain W3-18-1) GN=pyrG PE=3 SV=1 1 504 6.0E-134
sp|A4Y944|PYRG_SHEPC CTP synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pyrG PE=3 SV=1 1 504 6.0E-134
sp|Q6LMT0|PYRG_PHOPR CTP synthase OS=Photobacterium profundum GN=pyrG PE=3 SV=1 1 504 6.0E-134
sp|Q88MG1|PYRG_PSEPK CTP synthase OS=Pseudomonas putida (strain KT2440) GN=pyrG PE=3 SV=1 1 503 6.0E-134
sp|A5W831|PYRG_PSEP1 CTP synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pyrG PE=3 SV=1 1 503 6.0E-134
sp|A8LIN6|PYRG_DINSH CTP synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pyrG PE=3 SV=1 1 503 7.0E-134
sp|B0KSB7|PYRG_PSEPG CTP synthase OS=Pseudomonas putida (strain GB-1) GN=pyrG PE=3 SV=1 1 503 8.0E-134
sp|Q5WB43|PYRG_BACSK CTP synthase OS=Bacillus clausii (strain KSM-K16) GN=pyrG PE=3 SV=1 1 495 2.0E-133
sp|Q2SXC7|PYRG_BURTA CTP synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pyrG PE=3 SV=1 1 506 2.0E-133
sp|Q1DDB7|PYRG_MYXXD CTP synthase OS=Myxococcus xanthus (strain DK 1622) GN=pyrG PE=3 SV=1 1 508 3.0E-133
sp|A8FIE5|PYRG_BACP2 CTP synthase OS=Bacillus pumilus (strain SAFR-032) GN=pyrG PE=3 SV=1 1 503 3.0E-133
sp|Q465Q4|PYRG_METBF CTP synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pyrG PE=3 SV=1 1 502 3.0E-133
sp|Q0HL73|PYRG_SHESM CTP synthase OS=Shewanella sp. (strain MR-4) GN=pyrG PE=3 SV=1 1 504 3.0E-133
sp|Q2IWB8|PYRG_RHOP2 CTP synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=pyrG PE=3 SV=1 1 503 4.0E-133
sp|Q8NZF8|PYRG_STRP8 CTP synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pyrG PE=3 SV=1 1 503 4.0E-133
sp|C1CWM4|PYRG_DEIDV CTP synthase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=pyrG PE=3 SV=1 1 503 4.0E-133
sp|A4VJT9|PYRG_PSEU5 CTP synthase OS=Pseudomonas stutzeri (strain A1501) GN=pyrG PE=3 SV=1 1 503 4.0E-133
sp|Q1I644|PYRG_PSEE4 CTP synthase OS=Pseudomonas entomophila (strain L48) GN=pyrG PE=3 SV=1 1 503 4.0E-133
sp|Q1J4X1|PYRG_STRPF CTP synthase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pyrG PE=3 SV=1 1 503 4.0E-133
sp|A4XWS3|PYRG_PSEMY CTP synthase OS=Pseudomonas mendocina (strain ymp) GN=pyrG PE=3 SV=1 1 503 4.0E-133
sp|Q9A7K3|PYRG_CAUCR CTP synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|B8GW64|PYRG_CAUCN CTP synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|C4K4K0|PYRG_HAMD5 CTP synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|P0DD71|PYRG_STRPQ CTP synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|Q1JK23|PYRG_STRPC CTP synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|Q1J9X6|PYRG_STRPB CTP synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|Q5XA10|PYRG_STRP6 CTP synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|P0DD70|PYRG_STRP3 CTP synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|P65925|PYRG_STRP1 CTP synthase OS=Streptococcus pyogenes serotype M1 GN=pyrG PE=3 SV=1 1 503 6.0E-133
sp|A0M3I8|PYRG_GRAFK CTP synthase OS=Gramella forsetii (strain KT0803) GN=pyrG PE=3 SV=1 1 503 7.0E-133
sp|Q1JF16|PYRG_STRPD CTP synthase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pyrG PE=3 SV=1 1 503 7.0E-133
sp|C1DSS8|PYRG_AZOVD CTP synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pyrG PE=3 SV=1 1 503 9.0E-133
sp|Q1J055|PYRG_DEIGD CTP synthase OS=Deinococcus geothermalis (strain DSM 11300) GN=pyrG PE=3 SV=1 1 503 9.0E-133
sp|B0SYY1|PYRG_CAUSK CTP synthase OS=Caulobacter sp. (strain K31) GN=pyrG PE=3 SV=1 1 503 9.0E-133
sp|Q836G5|PYRG_ENTFA CTP synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pyrG PE=3 SV=1 1 503 1.0E-132
sp|A0KU81|PYRG_SHESA CTP synthase OS=Shewanella sp. (strain ANA-3) GN=pyrG PE=3 SV=1 1 504 1.0E-132
sp|Q8EBQ9|PYRG_SHEON CTP synthase OS=Shewanella oneidensis (strain MR-1) GN=pyrG PE=3 SV=1 1 504 1.0E-132
sp|Q81JW1|PYRG_BACAN CTP synthase OS=Bacillus anthracis GN=pyrG PE=3 SV=1 1 503 1.0E-132
sp|C3LFL2|PYRG_BACAC CTP synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pyrG PE=3 SV=1 1 503 1.0E-132
sp|C3P2A0|PYRG_BACAA CTP synthase OS=Bacillus anthracis (strain A0248) GN=pyrG PE=3 SV=1 1 503 1.0E-132
sp|P74208|PYRG_SYNY3 CTP synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyrG PE=3 SV=1 1 502 1.0E-132
sp|Q7NSG9|PYRG_CHRVO CTP synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pyrG PE=3 SV=1 1 503 1.0E-132
sp|A5GWT6|PYRG_SYNR3 CTP synthase OS=Synechococcus sp. (strain RCC307) GN=pyrG PE=3 SV=1 1 517 1.0E-132
sp|Q63SP8|PYRG_BURPS CTP synthase OS=Burkholderia pseudomallei (strain K96243) GN=pyrG PE=3 SV=1 1 506 2.0E-132
sp|Q3JQQ4|PYRG_BURP1 CTP synthase OS=Burkholderia pseudomallei (strain 1710b) GN=pyrG PE=3 SV=1 1 506 2.0E-132
sp|A1V5K4|PYRG_BURMS CTP synthase OS=Burkholderia mallei (strain SAVP1) GN=pyrG PE=3 SV=1 1 506 2.0E-132
sp|Q62J08|PYRG_BURMA CTP synthase OS=Burkholderia mallei (strain ATCC 23344) GN=pyrG PE=3 SV=1 1 506 2.0E-132
sp|A3ML79|PYRG_BURM7 CTP synthase OS=Burkholderia mallei (strain NCTC 10247) GN=pyrG PE=3 SV=1 1 506 2.0E-132
sp|A6LQF6|PYRG_CLOB8 CTP synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pyrG PE=3 SV=1 1 503 2.0E-132
sp|Q630R0|PYRG_BACCZ CTP synthase OS=Bacillus cereus (strain ZK / E33L) GN=pyrG PE=3 SV=1 1 503 2.0E-132
sp|B7JHG1|PYRG_BACC0 CTP synthase OS=Bacillus cereus (strain AH820) GN=pyrG PE=3 SV=1 1 503 2.0E-132
sp|C3K6H4|PYRG_PSEFS CTP synthase OS=Pseudomonas fluorescens (strain SBW25) GN=pyrG PE=3 SV=1 1 503 2.0E-132
sp|A4FKA9|PYRG_SACEN CTP synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pyrG PE=3 SV=1 1 508 3.0E-132
sp|A5UIK2|PYRG_HAEIG CTP synthase OS=Haemophilus influenzae (strain PittGG) GN=pyrG PE=3 SV=1 1 503 3.0E-132
sp|B7IQZ1|PYRG_BACC2 CTP synthase OS=Bacillus cereus (strain G9842) GN=pyrG PE=3 SV=1 1 503 3.0E-132
sp|Q65VZ8|PYRG_MANSM CTP synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pyrG PE=3 SV=2 1 503 3.0E-132
sp|Q48RF1|PYRG_STRPM CTP synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pyrG PE=3 SV=1 1 503 3.0E-132
sp|Q1LPI8|PYRG_CUPMC CTP synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pyrG PE=3 SV=1 1 503 4.0E-132
sp|B0JU82|PYRG_MICAN CTP synthase OS=Microcystis aeruginosa (strain NIES-843) GN=pyrG PE=3 SV=1 1 503 4.0E-132
sp|P44341|PYRG_HAEIN CTP synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pyrG PE=3 SV=1 1 503 4.0E-132
sp|Q8Y0B8|PYRG_RALSO CTP synthase OS=Ralstonia solanacearum (strain GMI1000) GN=pyrG PE=3 SV=1 1 515 4.0E-132
sp|Q5HXD1|PYRG_CAMJR CTP synthase OS=Campylobacter jejuni (strain RM1221) GN=pyrG PE=3 SV=1 1 503 5.0E-132
sp|A1VXA6|PYRG_CAMJJ CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pyrG PE=3 SV=1 1 503 5.0E-132
sp|A9VSD6|PYRG_BACWK CTP synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pyrG PE=3 SV=1 1 503 5.0E-132
sp|B9IRX1|PYRG_BACCQ CTP synthase OS=Bacillus cereus (strain Q1) GN=pyrG PE=3 SV=1 1 503 6.0E-132
sp|B7HY98|PYRG_BACC7 CTP synthase OS=Bacillus cereus (strain AH187) GN=pyrG PE=3 SV=1 1 503 6.0E-132
sp|Q4ZWR0|PYRG_PSEU2 CTP synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pyrG PE=3 SV=1 1 503 6.0E-132
sp|A4SRC2|PYRG_AERS4 CTP synthase OS=Aeromonas salmonicida (strain A449) GN=pyrG PE=3 SV=1 1 504 6.0E-132
sp|Q473G7|PYRG_CUPPJ CTP synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pyrG PE=3 SV=1 1 503 7.0E-132
sp|Q72XB0|PYRG_BACC1 CTP synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pyrG PE=3 SV=1 1 503 7.0E-132
sp|Q0KCE5|PYRG_CUPNH CTP synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pyrG PE=3 SV=1 1 509 7.0E-132
sp|Q31G66|PYRG_THICR CTP synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=pyrG PE=3 SV=1 1 504 7.0E-132
sp|A2SAU5|PYRG_BURM9 CTP synthase OS=Burkholderia mallei (strain NCTC 10229) GN=pyrG PE=3 SV=1 1 506 8.0E-132
sp|Q6HAU5|PYRG_BACHK CTP synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pyrG PE=3 SV=1 1 503 8.0E-132
sp|C1F0R6|PYRG_BACC3 CTP synthase OS=Bacillus cereus (strain 03BB102) GN=pyrG PE=3 SV=1 1 503 8.0E-132
sp|A0RLC3|PYRG_BACAH CTP synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=pyrG PE=3 SV=1 1 503 8.0E-132
sp|Q814T2|PYRG_BACCR CTP synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pyrG PE=3 SV=1 1 503 8.0E-132
sp|Q5LTV0|PYRG_RUEPO CTP synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pyrG PE=3 SV=1 1 503 1.0E-131
sp|Q886M5|PYRG_PSESM CTP synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pyrG PE=3 SV=1 1 503 1.0E-131
sp|Q9K6D7|PYRG_BACHD CTP synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrG PE=3 SV=1 1 503 2.0E-131
sp|Q8Q0L8|PYRG_METMA CTP synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pyrG PE=3 SV=1 1 502 2.0E-131
sp|B7HFN6|PYRG_BACC4 CTP synthase OS=Bacillus cereus (strain B4264) GN=pyrG PE=3 SV=1 1 503 2.0E-131
sp|A5UD28|PYRG_HAEIE CTP synthase OS=Haemophilus influenzae (strain PittEE) GN=pyrG PE=3 SV=1 1 503 2.0E-131
sp|Q03T27|PYRG_LACBA CTP synthase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pyrG PE=3 SV=1 1 504 2.0E-131
sp|Q9PJ84|PYRG_CAMJE CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pyrG PE=3 SV=1 1 503 2.0E-131
sp|Q7V9I0|PYRG_PROMA CTP synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=pyrG PE=3 SV=1 1 518 3.0E-131
sp|Q8EM53|PYRG_OCEIH CTP synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pyrG PE=3 SV=1 1 503 3.0E-131
sp|Q2JLG7|PYRG_SYNJB CTP synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pyrG PE=3 SV=1 1 503 3.0E-131
sp|Q5M6C0|PYRG_STRT2 CTP synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pyrG PE=3 SV=1 1 503 3.0E-131
sp|A7Z9T4|PYRG_BACMF CTP synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pyrG PE=3 SV=1 1 503 3.0E-131
sp|B2U9C0|PYRG_RALPJ CTP synthase OS=Ralstonia pickettii (strain 12J) GN=pyrG PE=3 SV=1 1 503 4.0E-131
sp|B1JK10|PYRG_YERPY CTP synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pyrG PE=3 SV=1 1 504 4.0E-131
sp|Q66ED9|PYRG_YERPS CTP synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pyrG PE=3 SV=1 1 504 4.0E-131
sp|A4TPY0|PYRG_YERPP CTP synthase OS=Yersinia pestis (strain Pestoides F) GN=pyrG PE=3 SV=1 1 504 4.0E-131
sp|Q1CLT3|PYRG_YERPN CTP synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pyrG PE=3 SV=1 1 504 4.0E-131
sp|A9R1D2|PYRG_YERPG CTP synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pyrG PE=3 SV=1 1 504 4.0E-131
sp|Q8ZBN1|PYRG_YERPE CTP synthase OS=Yersinia pestis GN=pyrG PE=3 SV=3 1 504 4.0E-131
sp|B2K560|PYRG_YERPB CTP synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pyrG PE=3 SV=1 1 504 4.0E-131
sp|Q1C3Y5|PYRG_YERPA CTP synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pyrG PE=3 SV=1 1 504 4.0E-131
sp|A7FLZ6|PYRG_YERP3 CTP synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pyrG PE=3 SV=1 1 504 4.0E-131
sp|A7GV88|PYRG_BACCN CTP synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pyrG PE=3 SV=1 1 503 4.0E-131
sp|Q2W6A0|PYRG_MAGSA CTP synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pyrG PE=3 SV=1 1 503 4.0E-131
sp|Q9HXZ4|PYRG_PSEAE CTP synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pyrG PE=3 SV=1 1 503 4.0E-131
sp|Q02RA9|PYRG_PSEAB CTP synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pyrG PE=3 SV=1 1 503 4.0E-131
sp|B7V7V1|PYRG_PSEA8 CTP synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=pyrG PE=3 SV=1 1 503 4.0E-131
sp|A6V1F1|PYRG_PSEA7 CTP synthase OS=Pseudomonas aeruginosa (strain PA7) GN=pyrG PE=3 SV=1 1 503 4.0E-131
sp|Q4QLL2|PYRG_HAEI8 CTP synthase OS=Haemophilus influenzae (strain 86-028NP) GN=pyrG PE=3 SV=1 1 503 5.0E-131
sp|Q9Z8U8|PYRG_CHLPN CTP synthase OS=Chlamydia pneumoniae GN=pyrG PE=3 SV=2 1 503 6.0E-131
sp|Q89KU5|PYRG_BRADU CTP synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pyrG PE=3 SV=1 1 503 6.0E-131
sp|A4WDW8|PYRG_ENT38 CTP synthase OS=Enterobacter sp. (strain 638) GN=pyrG PE=3 SV=1 1 504 6.0E-131
sp|B8IP92|PYRG_METNO CTP synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=pyrG PE=3 SV=1 1 503 6.0E-131
sp|Q48F77|PYRG_PSE14 CTP synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pyrG PE=3 SV=1 1 503 7.0E-131
sp|Q28MG4|PYRG_JANSC CTP synthase OS=Jannaschia sp. (strain CCS1) GN=pyrG PE=3 SV=1 1 503 7.0E-131
sp|Q1GTY6|PYRG_SPHAL CTP synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pyrG PE=3 SV=1 1 503 1.0E-130
sp|A6H0U1|PYRG_FLAPJ CTP synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pyrG PE=3 SV=1 1 503 1.0E-130
sp|B0U802|PYRG_METS4 CTP synthase OS=Methylobacterium sp. (strain 4-46) GN=pyrG PE=3 SV=1 1 503 1.0E-130
sp|Q5M1S7|PYRG_STRT1 CTP synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pyrG PE=3 SV=1 1 503 1.0E-130
sp|Q4KHF8|PYRG_PSEF5 CTP synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pyrG PE=3 SV=1 1 503 1.0E-130
sp|A5G5T3|PYRG_GEOUR CTP synthase OS=Geobacter uraniireducens (strain Rf4) GN=pyrG PE=3 SV=1 1 503 1.0E-130
sp|B2JIX2|PYRG_BURP8 CTP synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|Q07NF1|PYRG_RHOP5 CTP synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|C0MFQ9|PYRG_STRS7 CTP synthase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|Q97CR8|PYRG_THEVO CTP synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|Q2NVN8|PYRG_SODGM CTP synthase OS=Sodalis glossinidius (strain morsitans) GN=pyrG PE=3 SV=1 1 504 2.0E-130
sp|Q0A7K2|PYRG_ALKEH CTP synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|B8F5Q9|PYRG_HAEPS CTP synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|A1VLH3|PYRG_POLNA CTP synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=pyrG PE=3 SV=1 1 502 2.0E-130
sp|A1JJR3|PYRG_YERE8 CTP synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pyrG PE=3 SV=1 1 504 2.0E-130
sp|Q3KH94|PYRG_PSEPF CTP synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|C0M8K6|PYRG_STRE4 CTP synthase OS=Streptococcus equi subsp. equi (strain 4047) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|Q7MWR7|PYRG_PORGI CTP synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|B2RKS1|PYRG_PORG3 CTP synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|Q215B2|PYRG_RHOPB CTP synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|B4U6A9|PYRG_HYDS0 CTP synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=pyrG PE=3 SV=1 1 503 2.0E-130
sp|A5N3K4|PYRG_CLOK5 CTP synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pyrG PE=3 SV=1 1 499 3.0E-130
sp|B5FAG0|PYRG_VIBFM CTP synthase OS=Vibrio fischeri (strain MJ11) GN=pyrG PE=3 SV=1 1 504 3.0E-130
sp|B3Q6M4|PYRG_RHOPT CTP synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=pyrG PE=3 SV=1 1 503 3.0E-130
sp|Q6N5T4|PYRG_RHOPA CTP synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pyrG PE=3 SV=1 1 503 3.0E-130
sp|A1B8D4|PYRG_PARDP CTP synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=pyrG PE=3 SV=1 1 503 4.0E-130
sp|C1DCC1|PYRG_LARHH CTP synthase OS=Laribacter hongkongensis (strain HLHK9) GN=pyrG PE=3 SV=1 1 503 4.0E-130
sp|Q38V48|PYRG_LACSS CTP synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pyrG PE=3 SV=1 1 503 4.0E-130
sp|A6TD54|PYRG_KLEP7 CTP synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pyrG PE=3 SV=1 1 504 4.0E-130
sp|A1WWZ4|PYRG_HALHL CTP synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pyrG PE=3 SV=1 1 512 5.0E-130
sp|Q5E325|PYRG_VIBF1 CTP synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pyrG PE=3 SV=1 1 504 6.0E-130
sp|Q4FM39|PYRG_PELUB CTP synthase OS=Pelagibacter ubique (strain HTCC1062) GN=pyrG PE=3 SV=1 1 503 7.0E-130
sp|Q3SRJ8|PYRG_NITWN CTP synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pyrG PE=3 SV=1 1 503 7.0E-130
sp|Q1QMJ4|PYRG_NITHX CTP synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pyrG PE=3 SV=2 1 503 8.0E-130
sp|Q136D7|PYRG_RHOPS CTP synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=pyrG PE=3 SV=1 1 503 8.0E-130
sp|Q110M9|PYRG_TRIEI CTP synthase OS=Trichodesmium erythraeum (strain IMS101) GN=pyrG PE=3 SV=1 1 503 9.0E-130
sp|Q8YHF2|PYRG_BRUME CTP synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pyrG PE=3 SV=1 1 503 9.0E-130
sp|Q3A371|PYRG_PELCD CTP synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pyrG PE=3 SV=1 1 503 1.0E-129
sp|B2SXV1|PYRG_BURPP CTP synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=pyrG PE=3 SV=1 1 503 1.0E-129
sp|Q49Z73|PYRG_STAS1 CTP synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pyrG PE=3 SV=1 1 508 1.0E-129
sp|Q3Z6N1|PYRG_DEHM1 CTP synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pyrG PE=3 SV=1 1 515 1.0E-129
sp|Q6G027|PYRG_BARQU CTP synthase OS=Bartonella quintana (strain Toulouse) GN=pyrG PE=3 SV=1 1 502 1.0E-129
sp|B4EUF6|PYRG_PROMH CTP synthase OS=Proteus mirabilis (strain HI4320) GN=pyrG PE=3 SV=1 1 503 1.0E-129
sp|A8G9W0|PYRG_SERP5 CTP synthase OS=Serratia proteamaculans (strain 568) GN=pyrG PE=3 SV=1 1 504 1.0E-129
sp|A6VR01|PYRG_ACTSZ CTP synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|A5EK18|PYRG_BRASB CTP synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|B4TTY6|PYRG_SALSV CTP synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=pyrG PE=3 SV=1 1 504 2.0E-129
sp|B5XV18|PYRG_KLEP3 CTP synthase OS=Klebsiella pneumoniae (strain 342) GN=pyrG PE=3 SV=1 1 504 2.0E-129
sp|Q6G410|PYRG_BARHE CTP synthase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|A7MQY9|PYRG_CROS8 CTP synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pyrG PE=3 SV=1 1 504 2.0E-129
sp|B2S5Y5|PYRG_BRUA1 CTP synthase OS=Brucella abortus (strain S19) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|B4T484|PYRG_SALNS CTP synthase OS=Salmonella newport (strain SL254) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|B1YT11|PYRG_BURA4 CTP synthase OS=Burkholderia ambifaria (strain MC40-6) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|Q0BDS1|PYRG_BURCM CTP synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|A3MYK8|PYRG_ACTP2 CTP synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pyrG PE=3 SV=1 1 508 2.0E-129
sp|Q8E7P8|PYRG_STRA3 CTP synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|Q3K3S2|PYRG_STRA1 CTP synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pyrG PE=3 SV=1 1 503 2.0E-129
sp|A4YVC9|PYRG_BRASO CTP synthase OS=Bradyrhizobium sp. (strain ORS278) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|P65921|PYRG_SALTY CTP synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pyrG PE=3 SV=2 1 503 3.0E-129
sp|P65922|PYRG_SALTI CTP synthase OS=Salmonella typhi GN=pyrG PE=3 SV=2 1 503 3.0E-129
sp|C0PXD6|PYRG_SALPC CTP synthase OS=Salmonella paratyphi C (strain RKS4594) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|A9N2F5|PYRG_SALPB CTP synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|B4TFZ2|PYRG_SALHS CTP synthase OS=Salmonella heidelberg (strain SL476) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|B5RDS6|PYRG_SALG2 CTP synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|B5QW41|PYRG_SALEP CTP synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|B5FTV0|PYRG_SALDC CTP synthase OS=Salmonella dublin (strain CT_02021853) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|Q57KG9|PYRG_SALCH CTP synthase OS=Salmonella choleraesuis (strain SC-B67) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|B6EKL9|PYRG_ALISL CTP synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=pyrG PE=3 SV=1 1 504 3.0E-129
sp|Q7VW76|PYRG_BORPE CTP synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pyrG PE=3 SV=1 1 516 3.0E-129
sp|Q7W5N6|PYRG_BORPA CTP synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pyrG PE=3 SV=1 1 516 3.0E-129
sp|Q7WD72|PYRG_BORBR CTP synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pyrG PE=3 SV=1 1 516 3.0E-129
sp|B4EDA3|PYRG_BURCJ CTP synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|B1JUY8|PYRG_BURCC CTP synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=pyrG PE=3 SV=1 1 503 3.0E-129
sp|Q13X05|PYRG_BURXL CTP synthase OS=Burkholderia xenovorans (strain LB400) GN=pyrG PE=3 SV=1 1 503 4.0E-129
sp|A1SSQ6|PYRG_PSYIN CTP synthase OS=Psychromonas ingrahamii (strain 37) GN=pyrG PE=3 SV=1 1 503 4.0E-129
sp|Q8E290|PYRG_STRA5 CTP synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pyrG PE=3 SV=1 1 503 4.0E-129
sp|A0K8N3|PYRG_BURCH CTP synthase OS=Burkholderia cenocepacia (strain HI2424) GN=pyrG PE=3 SV=1 1 503 4.0E-129
sp|Q1BHS2|PYRG_BURCA CTP synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=pyrG PE=3 SV=1 1 503 4.0E-129
sp|Q980S6|PYRG_SULSO CTP synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pyrG PE=1 SV=1 1 506 5.0E-129
sp|Q39EV7|PYRG_BURL3 CTP synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pyrG PE=3 SV=1 1 503 5.0E-129
sp|A8ANY8|PYRG_CITK8 CTP synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pyrG PE=3 SV=1 1 504 5.0E-129
sp|Q8AA75|PYRG_BACTN CTP synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pyrG PE=3 SV=1 1 503 5.0E-129
sp|Q9CJW9|PYRG_PASMU CTP synthase OS=Pasteurella multocida (strain Pm70) GN=pyrG PE=3 SV=1 1 503 6.0E-129
sp|Q2K871|PYRG_RHIEC CTP synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pyrG PE=3 SV=1 1 503 7.0E-129
sp|Q0I200|PYRG_HAES1 CTP synthase OS=Haemophilus somnus (strain 129Pt) GN=pyrG PE=3 SV=2 1 504 7.0E-129
sp|Q1QZX9|PYRG_CHRSD CTP synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pyrG PE=3 SV=1 1 500 8.0E-129
sp|Q7VNV5|PYRG_HAEDU CTP synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pyrG PE=3 SV=1 1 508 9.0E-129
sp|Q57D05|PYRG_BRUAB CTP synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=pyrG PE=3 SV=1 1 503 9.0E-129
sp|Q2YPU8|PYRG_BRUA2 CTP synthase OS=Brucella abortus (strain 2308) GN=pyrG PE=3 SV=1 1 503 9.0E-129
sp|B5BF03|PYRG_SALPK CTP synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=pyrG PE=3 SV=1 1 503 9.0E-129
sp|Q5PEJ0|PYRG_SALPA CTP synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pyrG PE=3 SV=1 1 503 9.0E-129
sp|B5F4P0|PYRG_SALA4 CTP synthase OS=Salmonella agona (strain SL483) GN=pyrG PE=3 SV=1 1 503 9.0E-129
sp|Q8UEY5|PYRG_AGRFC CTP synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pyrG PE=3 SV=2 1 503 1.0E-128
sp|B0CGT4|PYRG_BRUSI CTP synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|A3CQB0|PYRG_STRSV CTP synthase OS=Streptococcus sanguinis (strain SK36) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|A5VQQ9|PYRG_BRUO2 CTP synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|C0RJA5|PYRG_BRUMB CTP synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|B2VFY9|PYRG_ERWT9 CTP synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pyrG PE=3 SV=1 1 512 1.0E-128
sp|Q1GF61|PYRG_RUEST CTP synthase OS=Ruegeria sp. (strain TM1040) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|Q88Z76|PYRG_LACPL CTP synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|Q1MGC4|PYRG_RHIL3 CTP synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|A3MXN2|PYRG_PYRCJ CTP synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|Q3ZYU1|PYRG_DEHMC CTP synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=pyrG PE=3 SV=1 1 515 1.0E-128
sp|A5FPS8|PYRG_DEHMB CTP synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pyrG PE=3 SV=1 1 515 1.0E-128
sp|B3Q0M2|PYRG_RHIE6 CTP synthase OS=Rhizobium etli (strain CIAT 652) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|A6X0L6|PYRG_OCHA4 CTP synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|A4JFY7|PYRG_BURVG CTP synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|A9IS43|PYRG_BART1 CTP synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pyrG PE=3 SV=1 1 503 1.0E-128
sp|B7KUU9|PYRG_METC4 CTP synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|B0BS41|PYRG_ACTPJ CTP synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|B3GZX8|PYRG_ACTP7 CTP synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|Q39W62|PYRG_GEOMG CTP synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|B1Z9R0|PYRG_METPB CTP synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|Q3J0Z1|PYRG_RHOS4 CTP synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|B9MEQ7|PYRG_ACIET CTP synthase OS=Acidovorax ebreus (strain TPSY) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|Q7VGH1|PYRG_HELHP CTP synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=pyrG PE=3 SV=1 1 500 2.0E-128
sp|A8AZ08|PYRG_STRGC CTP synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|A9MF10|PYRG_SALAR CTP synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pyrG PE=3 SV=1 1 504 2.0E-128
sp|Q8CNI2|PYRG_STAES CTP synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|Q5HM95|PYRG_STAEQ CTP synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pyrG PE=3 SV=1 1 503 2.0E-128
sp|Q2FWD1|PYRG_STAA8 CTP synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=pyrG PE=3 SV=1 1 496 3.0E-128
sp|B9KKB0|PYRG_RHOSK CTP synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pyrG PE=3 SV=1 1 503 3.0E-128
sp|A3PLA0|PYRG_RHOS1 CTP synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pyrG PE=3 SV=1 1 503 3.0E-128
sp|Q5L5S1|PYRG_CHLAB CTP synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=pyrG PE=3 SV=1 1 503 3.0E-128
sp|C5B8X3|PYRG_EDWI9 CTP synthase OS=Edwardsiella ictaluri (strain 93-146) GN=pyrG PE=3 SV=1 1 504 3.0E-128
sp|Q6A7X4|PYRG_PROAC CTP synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pyrG PE=3 SV=1 1 488 3.0E-128
sp|B8D7U6|PYRG_BUCAT CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pyrG PE=3 SV=1 1 504 3.0E-128
sp|B7UHJ6|PYRG_ECO27 CTP synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pyrG PE=3 SV=1 1 504 3.0E-128
sp|Q11S24|PYRG_CYTH3 CTP synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pyrG PE=3 SV=1 1 503 3.0E-128
sp|A2C5F9|PYRG_PROM1 CTP synthase OS=Prochlorococcus marinus (strain NATL1A) GN=pyrG PE=3 SV=1 1 503 4.0E-128
sp|B6J4W8|PYRG_COXB1 CTP synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=pyrG PE=3 SV=1 1 503 4.0E-128
sp|Q73HS5|PYRG_WOLPM CTP synthase OS=Wolbachia pipientis wMel GN=pyrG PE=3 SV=1 1 503 4.0E-128
sp|A9KDH0|PYRG_COXBN CTP synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pyrG PE=3 SV=1 1 503 4.0E-128
sp|A7MTS6|PYRG_VIBCB CTP synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pyrG PE=3 SV=1 1 504 4.0E-128
sp|P57491|PYRG_BUCAI CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pyrG PE=3 SV=1 1 504 4.0E-128
sp|A9AGW0|PYRG_BURM1 CTP synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=pyrG PE=3 SV=1 1 503 5.0E-128
sp|B5ZPZ7|PYRG_RHILW CTP synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pyrG PE=3 SV=1 1 503 5.0E-128
sp|B9M9Q5|PYRG_GEODF CTP synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=pyrG PE=3 SV=1 1 503 5.0E-128
sp|Q2KZF8|PYRG_BORA1 CTP synthase OS=Bordetella avium (strain 197N) GN=pyrG PE=3 SV=1 1 514 5.0E-128
sp|B8GQ73|PYRG_THISH CTP synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=pyrG PE=3 SV=1 1 503 6.0E-128
sp|Q0VQD8|PYRG_ALCBS CTP synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pyrG PE=3 SV=1 1 503 6.0E-128
sp|P65924|PYRG_STAAW CTP synthase OS=Staphylococcus aureus (strain MW2) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|A8YY92|PYRG_STAAT CTP synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|Q6G7I3|PYRG_STAAS CTP synthase OS=Staphylococcus aureus (strain MSSA476) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|Q6GEU8|PYRG_STAAR CTP synthase OS=Staphylococcus aureus (strain MRSA252) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|P99072|PYRG_STAAN CTP synthase OS=Staphylococcus aureus (strain N315) GN=pyrG PE=1 SV=1 1 496 6.0E-128
sp|P65923|PYRG_STAAM CTP synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|A6QIX1|PYRG_STAAE CTP synthase OS=Staphylococcus aureus (strain Newman) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|Q5HE73|PYRG_STAAC CTP synthase OS=Staphylococcus aureus (strain COL) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|Q2YUM6|PYRG_STAAB CTP synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|A5IUS2|PYRG_STAA9 CTP synthase OS=Staphylococcus aureus (strain JH9) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|Q2FF01|PYRG_STAA3 CTP synthase OS=Staphylococcus aureus (strain USA300) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|A6U3L2|PYRG_STAA2 CTP synthase OS=Staphylococcus aureus (strain JH1) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|A7X4X7|PYRG_STAA1 CTP synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pyrG PE=3 SV=1 1 496 6.0E-128
sp|Q7V3W8|PYRG_PROMM CTP synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=pyrG PE=3 SV=1 1 503 8.0E-128
sp|C5CSV3|PYRG_VARPS CTP synthase OS=Variovorax paradoxus (strain S110) GN=pyrG PE=3 SV=1 1 503 8.0E-128
sp|Q3AGF7|PYRG_SYNSC CTP synthase OS=Synechococcus sp. (strain CC9605) GN=pyrG PE=3 SV=1 1 517 9.0E-128
sp|Q2IH81|PYRG_ANADE CTP synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pyrG PE=3 SV=1 1 503 9.0E-128
sp|A5FHA4|PYRG_FLAJ1 CTP synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pyrG PE=3 SV=1 1 506 1.0E-127
sp|B4RVU4|PYRG_ALTMD CTP synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|Q46I97|PYRG_PROMT CTP synthase OS=Prochlorococcus marinus (strain NATL2A) GN=pyrG PE=3 SV=1 1 503 1.0E-127
sp|B8JBN6|PYRG_ANAD2 CTP synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pyrG PE=3 SV=1 1 503 1.0E-127
sp|Q3YY76|PYRG_SHISS CTP synthase OS=Shigella sonnei (strain Ss046) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|P0A7E8|PYRG_SHIFL CTP synthase OS=Shigella flexneri GN=pyrG PE=3 SV=2 1 504 1.0E-127
sp|Q0T1P8|PYRG_SHIF8 CTP synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|Q32CD5|PYRG_SHIDS CTP synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|Q31XL0|PYRG_SHIBS CTP synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B2TZF3|PYRG_SHIB3 CTP synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B7LWP4|PYRG_ESCF3 CTP synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|Q1R7R3|PYRG_ECOUT CTP synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B1LQB3|PYRG_ECOSM CTP synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B6I6H6|PYRG_ECOSE CTP synthase OS=Escherichia coli (strain SE11) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B7N716|PYRG_ECOLU CTP synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|P0A7E5|PYRG_ECOLI CTP synthase OS=Escherichia coli (strain K12) GN=pyrG PE=1 SV=2 1 504 1.0E-127
sp|B1IU61|PYRG_ECOLC CTP synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|P0A7E6|PYRG_ECOL6 CTP synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pyrG PE=3 SV=2 1 504 1.0E-127
sp|Q0TE79|PYRG_ECOL5 CTP synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|A1AEW8|PYRG_ECOK1 CTP synthase OS=Escherichia coli O1:K1 / APEC GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|A8A3R5|PYRG_ECOHS CTP synthase OS=Escherichia coli O9:H4 (strain HS) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B1XDJ0|PYRG_ECODH CTP synthase OS=Escherichia coli (strain K12 / DH10B) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|C4ZZT3|PYRG_ECOBW CTP synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B7LXJ6|PYRG_ECO8A CTP synthase OS=Escherichia coli O8 (strain IAI1) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B7MZ76|PYRG_ECO81 CTP synthase OS=Escherichia coli O81 (strain ED1a) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B7NV70|PYRG_ECO7I CTP synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B5Z3E4|PYRG_ECO5E CTP synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|P0A7E7|PYRG_ECO57 CTP synthase OS=Escherichia coli O157:H7 GN=pyrG PE=3 SV=2 1 504 1.0E-127
sp|B7LEK0|PYRG_ECO55 CTP synthase OS=Escherichia coli (strain 55989 / EAEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B7MLA1|PYRG_ECO45 CTP synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|A7ZQM3|PYRG_ECO24 CTP synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|B1Y4K6|PYRG_LEPCP CTP synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pyrG PE=3 SV=1 1 491 1.0E-127
sp|Q310T4|PYRG_DESAG CTP synthase OS=Desulfovibrio alaskensis (strain G20) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|C6DDJ6|PYRG_PECCP CTP synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pyrG PE=3 SV=1 1 509 1.0E-127
sp|Q87LP9|PYRG_VIBPA CTP synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pyrG PE=3 SV=1 1 504 1.0E-127
sp|Q8G0G1|PYRG_BRUSU CTP synthase OS=Brucella suis biovar 1 (strain 1330) GN=pyrG PE=3 SV=1 1 503 1.0E-127
sp|A9M5E7|PYRG_BRUC2 CTP synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pyrG PE=3 SV=1 1 503 1.0E-127
sp|Q6MPP0|PYRG_BDEBA CTP synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pyrG PE=3 SV=2 1 503 1.0E-127
sp|B8D9J4|PYRG_BUCA5 CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pyrG PE=3 SV=1 1 504 2.0E-127
sp|B6J3W7|PYRG_COXB2 CTP synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=pyrG PE=3 SV=1 1 503 2.0E-127
sp|Q74BY3|PYRG_GEOSL CTP synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pyrG PE=3 SV=1 1 509 2.0E-127
sp|B4RBW5|PYRG_PHEZH CTP synthase OS=Phenylobacterium zucineum (strain HLK1) GN=pyrG PE=3 SV=1 1 503 2.0E-127
sp|Q6D181|PYRG_PECAS CTP synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pyrG PE=3 SV=1 1 509 2.0E-127
sp|A9BN39|PYRG_DELAS CTP synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=pyrG PE=3 SV=1 1 503 3.0E-127
sp|Q47QN2|PYRG_THEFY CTP synthase OS=Thermobifida fusca (strain YX) GN=pyrG PE=3 SV=2 1 503 3.0E-127
sp|B4UIT6|PYRG_ANASK CTP synthase OS=Anaeromyxobacter sp. (strain K) GN=pyrG PE=3 SV=1 1 503 4.0E-127
sp|A4SXE7|PYRG_POLSQ CTP synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=pyrG PE=3 SV=1 1 503 4.0E-127
sp|A1W4R3|PYRG_ACISJ CTP synthase OS=Acidovorax sp. (strain JS42) GN=pyrG PE=3 SV=1 1 503 4.0E-127
sp|A2CDX8|PYRG_PROM3 CTP synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=pyrG PE=3 SV=1 1 519 4.0E-127
sp|Q97S93|PYRG_STRPN CTP synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pyrG PE=3 SV=1 1 503 5.0E-127
sp|B8EJS8|PYRG_METSB CTP synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=pyrG PE=3 SV=1 1 503 5.0E-127
sp|Q8DQY0|PYRG_STRR6 CTP synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pyrG PE=3 SV=1 1 503 7.0E-127
sp|B8DJR8|PYRG_DESVM CTP synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=pyrG PE=3 SV=1 1 503 8.0E-127
sp|B9DME0|PYRG_STACT CTP synthase OS=Staphylococcus carnosus (strain TM300) GN=pyrG PE=3 SV=1 1 503 8.0E-127
sp|Q47WQ9|PYRG_COLP3 CTP synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pyrG PE=3 SV=1 1 503 8.0E-127
sp|A6U8E2|PYRG_SINMW CTP synthase OS=Sinorhizobium medicae (strain WSM419) GN=pyrG PE=3 SV=1 1 503 8.0E-127
sp|C3LQZ1|PYRG_VIBCM CTP synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pyrG PE=3 SV=1 1 504 8.0E-127
sp|Q9KPC4|PYRG_VIBCH CTP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pyrG PE=3 SV=3 1 504 8.0E-127
sp|A5F5I4|PYRG_VIBC3 CTP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pyrG PE=3 SV=1 1 504 8.0E-127
sp|O67353|PYRG_AQUAE CTP synthase OS=Aquifex aeolicus (strain VF5) GN=pyrG PE=3 SV=1 1 508 9.0E-127
sp|Q7U3K4|PYRG_SYNPX CTP synthase OS=Synechococcus sp. (strain WH8102) GN=pyrG PE=3 SV=1 1 503 1.0E-126
sp|Q8DWG1|PYRG_STRMU CTP synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pyrG PE=3 SV=1 1 503 1.0E-126
sp|B3EAK5|PYRG_GEOLS CTP synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pyrG PE=3 SV=1 1 503 2.0E-126
sp|Q2J878|PYRG_FRASC CTP synthase OS=Frankia sp. (strain CcI3) GN=pyrG PE=3 SV=1 1 509 2.0E-126
sp|Q7UJ86|PYRG_RHOBA CTP synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pyrG PE=3 SV=1 1 520 2.0E-126
sp|A4WQW2|PYRG_RHOS5 CTP synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=pyrG PE=3 SV=1 1 503 2.0E-126
sp|Q5R142|PYRG_IDILO CTP synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pyrG PE=3 SV=1 1 504 2.0E-126
sp|A5V8U1|PYRG_SPHWW CTP synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=pyrG PE=3 SV=1 1 503 2.0E-126
sp|Q1MR71|PYRG_LAWIP CTP synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=pyrG PE=3 SV=1 1 504 2.0E-126
sp|Q254V9|PYRG_CHLFF CTP synthase OS=Chlamydophila felis (strain Fe/C-56) GN=pyrG PE=3 SV=1 1 503 3.0E-126
sp|Q83B36|PYRG_COXBU CTP synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pyrG PE=3 SV=1 1 503 3.0E-126
sp|Q83IC4|PYRG_TROW8 CTP synthase OS=Tropheryma whipplei (strain TW08/27) GN=pyrG PE=3 SV=1 1 503 3.0E-126
sp|O25116|PYRG_HELPY CTP synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pyrG PE=3 SV=1 1 503 3.0E-126
sp|Q5GTB4|PYRG_WOLTR CTP synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=pyrG PE=3 SV=1 1 504 3.0E-126
sp|Q83GX8|PYRG_TROWT CTP synthase OS=Tropheryma whipplei (strain Twist) GN=pyrG PE=3 SV=1 1 503 3.0E-126
sp|B1M5Q9|PYRG_METRJ CTP synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=pyrG PE=3 SV=1 1 503 3.0E-126
sp|Q0BTX6|PYRG_GRABC CTP synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pyrG PE=3 SV=1 1 503 3.0E-126
sp|Q9YBJ4|PYRG_AERPE CTP synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pyrG PE=3 SV=1 1 504 4.0E-126
sp|A1TLT0|PYRG_ACIAC CTP synthase OS=Acidovorax citrulli (strain AAC00-1) GN=pyrG PE=3 SV=1 1 503 4.0E-126
sp|Q1CUG1|PYRG_HELPH CTP synthase OS=Helicobacter pylori (strain HPAG1) GN=pyrG PE=3 SV=1 1 503 4.0E-126
sp|Q92QA0|PYRG_RHIME CTP synthase OS=Rhizobium meliloti (strain 1021) GN=pyrG PE=3 SV=1 1 503 5.0E-126
sp|A1WL89|PYRG_VEREI CTP synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pyrG PE=3 SV=1 1 503 6.0E-126
sp|Q11HU6|PYRG_CHESB CTP synthase OS=Chelativorans sp. (strain BNC1) GN=pyrG PE=3 SV=2 1 503 7.0E-126
sp|A5GPM2|PYRG_SYNPW CTP synthase OS=Synechococcus sp. (strain WH7803) GN=pyrG PE=3 SV=1 1 503 8.0E-126
sp|Q822T2|PYRG_CHLCV CTP synthase OS=Chlamydophila caviae (strain GPIC) GN=pyrG PE=3 SV=1 1 503 9.0E-126
sp|Q98MF0|PYRG_RHILO CTP synthase OS=Rhizobium loti (strain MAFF303099) GN=pyrG PE=3 SV=1 1 503 9.0E-126
sp|Q6AGG5|PYRG_LEIXX CTP synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pyrG PE=3 SV=2 1 509 9.0E-126
sp|Q5FME6|PYRG_LACAC CTP synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pyrG PE=3 SV=1 1 505 1.0E-125
sp|Q7MHQ0|PYRG_VIBVY CTP synthase OS=Vibrio vulnificus (strain YJ016) GN=pyrG PE=3 SV=2 1 504 1.0E-125
sp|Q8DC63|PYRG_VIBVU CTP synthase OS=Vibrio vulnificus (strain CMCP6) GN=pyrG PE=3 SV=1 1 504 1.0E-125
sp|B7VK69|PYRG_VIBTL CTP synthase OS=Vibrio tasmaniensis (strain LGP32) GN=pyrG PE=3 SV=1 1 504 1.0E-125
sp|A1TZ46|PYRG_MARHV CTP synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pyrG PE=3 SV=1 1 503 1.0E-125
sp|B1XUS0|PYRG_POLNS CTP synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=pyrG PE=3 SV=1 1 503 2.0E-125
sp|Q168S7|PYRG_ROSDO CTP synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pyrG PE=3 SV=1 1 503 2.0E-125
sp|A7HIF0|PYRG_ANADF CTP synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pyrG PE=3 SV=1 1 503 2.0E-125
sp|B2I2A7|PYRG_ACIBC CTP synthase OS=Acinetobacter baumannii (strain ACICU) GN=pyrG PE=3 SV=1 1 503 2.0E-125
sp|A1US92|PYRG_BARBK CTP synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pyrG PE=3 SV=1 1 502 3.0E-125
sp|Q2GHT7|PYRG_EHRCR CTP synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=pyrG PE=3 SV=1 1 503 3.0E-125
sp|Q8ZSY7|PYRG_PYRAE CTP synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pyrG PE=3 SV=1 1 503 3.0E-125
sp|Q128E7|PYRG_POLSJ CTP synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pyrG PE=3 SV=1 1 487 3.0E-125
[Show less]

GO

GO Term Description Terminal node
GO:0003883 CTP synthase activity Yes
GO:0016787 hydrolase activity Yes
GO:0006221 pyrimidine nucleotide biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0003824 catalytic activity No
GO:0072528 pyrimidine-containing compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0008150 biological_process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009117 nucleotide metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006220 pyrimidine nucleotide metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5266
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4311
Ophiocordyceps australis map64 (Brazil) OphauB2|5544 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01857
Ophiocordyceps camponoti-rufipedis Ophun1|6712
Ophiocordyceps kimflemingae Ophio5|590
Ophiocordyceps subramaniannii Hirsu2|4558

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5544
MNPKEHGECFVLQDGGESDLDLGNYERYLGLDLTRDNNITTGKIYKQVIEKERRGDYLGRTVQVVPHVTTAIIEH
IERVAKIAVDKSDVEPDVCIVELGGTVGDIESMPFVEALTQLRHKAGKANFINIHVSYIPIVNGEQKTKPTQYAV
KSVRSAGLIPDLIACRCERPLEQVTMDKIAQSCQVEVEQVVAVRDMPTIYQVPILLEQQGLLDLLRQTLSLEQVA
LTPSLVAKGAETWRMWNEIIPQEHSAKLDIALVGKYVELPDAYLSTVKSLEHSAMRCGRKLNLIWVDSEQLEDKT
QRSDPVCFYKAWHLVSTAAGVLVPGGFGQRGTEGMIKAAQWARERKRPYLGVCLGMQIAVIEFARHVCAMANATS
EEFDAQAEHRLIIFMPEGSKNTMGGTMRLGSRATHFQPGSEYSKLRALYGEATSILERHRHRYEVNPDYVDALDA
AGMTFIGKDDSGNRMEIFELKDHPWFVGVQYHPEYLSRVLDPSRPYLGFVAAAAGCLDRITQQALEQTTNGQSTF
*
Coding >OphauB2|5544
ATGAACCCCAAGGAGCACGGGGAATGCTTCGTGCTTCAAGATGGCGGTGAATCGGATCTGGATCTAGGCAACTAT
GAACGCTACCTCGGCCTTGACCTGACCAGAGACAATAACATCACGACGGGCAAGATTTACAAACAGGTGATTGAA
AAGGAGCGAAGAGGCGACTACTTGGGACGCACTGTGCAAGTGGTTCCTCATGTCACGACGGCCATTATAGAACAC
ATTGAGCGTGTGGCCAAGATTGCTGTGGACAAGTCGGACGTGGAGCCAGACGTATGCATTGTTGAACTGGGCGGC
ACGGTGGGCGACATTGAGAGTATGCCGTTTGTCGAGGCTCTGACGCAGCTGCGGCACAAGGCGGGCAAGGCCAAC
TTTATCAACATCCACGTCTCATACATACCCATTGTCAATGGCGAGCAAAAGACAAAACCAACCCAGTACGCTGTC
AAGAGCGTCCGCAGTGCCGGCCTCATACCCGACTTGATTGCTTGTCGTTGCGAGCGCCCGCTCGAGCAGGTGACG
ATGGACAAGATTGCCCAGAGCTGCCAGGTCGAGGTGGAGCAAGTTGTTGCCGTGCGCGACATGCCCACCATTTAC
CAGGTGCCCATTTTGCTCGAGCAGCAAGGCCTCTTGGATCTCCTGCGCCAGACACTCAGCCTCGAGCAGGTGGCC
CTGACACCCTCGCTCGTGGCCAAGGGGGCTGAGACGTGGCGCATGTGGAACGAGATTATTCCCCAGGAGCATTCT
GCCAAGCTGGACATTGCCCTGGTGGGCAAGTATGTTGAACTGCCCGATGCCTACCTGTCGACGGTCAAGTCGCTG
GAGCACTCGGCCATGCGCTGCGGCCGCAAGCTCAACCTCATTTGGGTCGACTCGGAGCAGCTCGAGGACAAGACG
CAACGAAGTGATCCCGTTTGCTTCTACAAGGCCTGGCACCTTGTGTCGACGGCCGCTGGCGTGCTCGTGCCTGGC
GGATTCGGCCAGCGCGGCACCGAGGGCATGATCAAGGCGGCCCAGTGGGCTCGTGAGCGCAAACGACCCTATCTG
GGTGTCTGCCTGGGCATGCAGATTGCCGTCATCGAGTTTGCCCGACACGTGTGCGCCATGGCCAATGCCACGTCG
GAGGAGTTTGACGCGCAGGCCGAGCACCGCCTCATCATCTTCATGCCCGAGGGCTCCAAGAACACCATGGGCGGC
ACCATGCGCCTGGGCTCGCGCGCCACCCACTTCCAGCCGGGCAGCGAGTACAGCAAGCTGCGCGCCCTGTATGGC
GAGGCGACTAGTATCCTGGAGCGCCACCGCCACCGCTACGAAGTTAACCCCGACTATGTCGATGCGCTTGACGCG
GCCGGCATGACCTTTATCGGCAAGGACGACTCGGGCAACCGCATGGAGATTTTTGAGCTTAAGGACCACCCTTGG
TTTGTGGGTGTGCAGTATCACCCCGAGTACCTGAGTCGTGTGCTGGATCCCTCGCGTCCCTATCTCGGCTTTGTT
GCCGCTGCGGCTGGTTGTCTGGACCGCATAACGCAGCAGGCCTTGGAGCAGACAACAAATGGCCAATCTACTTTT
TAA
Transcript >OphauB2|5544
ATGAACCCCAAGGAGCACGGGGAATGCTTCGTGCTTCAAGATGGCGGTGAATCGGATCTGGATCTAGGCAACTAT
GAACGCTACCTCGGCCTTGACCTGACCAGAGACAATAACATCACGACGGGCAAGATTTACAAACAGGTGATTGAA
AAGGAGCGAAGAGGCGACTACTTGGGACGCACTGTGCAAGTGGTTCCTCATGTCACGACGGCCATTATAGAACAC
ATTGAGCGTGTGGCCAAGATTGCTGTGGACAAGTCGGACGTGGAGCCAGACGTATGCATTGTTGAACTGGGCGGC
ACGGTGGGCGACATTGAGAGTATGCCGTTTGTCGAGGCTCTGACGCAGCTGCGGCACAAGGCGGGCAAGGCCAAC
TTTATCAACATCCACGTCTCATACATACCCATTGTCAATGGCGAGCAAAAGACAAAACCAACCCAGTACGCTGTC
AAGAGCGTCCGCAGTGCCGGCCTCATACCCGACTTGATTGCTTGTCGTTGCGAGCGCCCGCTCGAGCAGGTGACG
ATGGACAAGATTGCCCAGAGCTGCCAGGTCGAGGTGGAGCAAGTTGTTGCCGTGCGCGACATGCCCACCATTTAC
CAGGTGCCCATTTTGCTCGAGCAGCAAGGCCTCTTGGATCTCCTGCGCCAGACACTCAGCCTCGAGCAGGTGGCC
CTGACACCCTCGCTCGTGGCCAAGGGGGCTGAGACGTGGCGCATGTGGAACGAGATTATTCCCCAGGAGCATTCT
GCCAAGCTGGACATTGCCCTGGTGGGCAAGTATGTTGAACTGCCCGATGCCTACCTGTCGACGGTCAAGTCGCTG
GAGCACTCGGCCATGCGCTGCGGCCGCAAGCTCAACCTCATTTGGGTCGACTCGGAGCAGCTCGAGGACAAGACG
CAACGAAGTGATCCCGTTTGCTTCTACAAGGCCTGGCACCTTGTGTCGACGGCCGCTGGCGTGCTCGTGCCTGGC
GGATTCGGCCAGCGCGGCACCGAGGGCATGATCAAGGCGGCCCAGTGGGCTCGTGAGCGCAAACGACCCTATCTG
GGTGTCTGCCTGGGCATGCAGATTGCCGTCATCGAGTTTGCCCGACACGTGTGCGCCATGGCCAATGCCACGTCG
GAGGAGTTTGACGCGCAGGCCGAGCACCGCCTCATCATCTTCATGCCCGAGGGCTCCAAGAACACCATGGGCGGC
ACCATGCGCCTGGGCTCGCGCGCCACCCACTTCCAGCCGGGCAGCGAGTACAGCAAGCTGCGCGCCCTGTATGGC
GAGGCGACTAGTATCCTGGAGCGCCACCGCCACCGCTACGAAGTTAACCCCGACTATGTCGATGCGCTTGACGCG
GCCGGCATGACCTTTATCGGCAAGGACGACTCGGGCAACCGCATGGAGATTTTTGAGCTTAAGGACCACCCTTGG
TTTGTGGGTGTGCAGTATCACCCCGAGTACCTGAGTCGTGTGCTGGATCCCTCGCGTCCCTATCTCGGCTTTGTT
GCCGCTGCGGCTGGTTGTCTGGACCGCATAACGCAGCAGGCCTTGGAGCAGACAACAAATGGCCAATCTACTTTT
TAA
Gene >OphauB2|5544
ATGAACCCCAAGGAGTCAGTTTGTCCCAGCACGGTTTATCCGGGAAGAGGCTGCATGCTAATTGCAACTGGTGGC
ACAGGCACGGGGAATGCTTCGTGCTTCAAGATGGCGGTGAATCGGATCTGGATCTAGGCAACTATGAACGGTACG
CAGCCAAGAGGCGCGATGGTGGCATCCAAGACTGTTGACGCGTTGCAACGACGATAGCTACCTCGGCCTTGACCT
GACCAGAGACAATAACATCACGACGGGCAAGATTTACAAACAGGTGATTGAAAAGGAGCGAAGAGGCGACTACTT
GGGACGCACTGTGCAAGTGGTTCCTCATGTCACGACGGCCATTATAGAACACATTGAGCGTGTGGCCAAGATTGC
TGTGGACAAGTCGGACGTGGAGCCAGACGTATGCATTGGTAAGCTTGCCCATGAGCCACGACCGGCCAGGATGAT
GGACTCCTAACAGGGCGCAACAGTTGAACTGGTGCGTATTTGCCCCTCGTGGACCCAAGAGGGCCATGGAGCGTG
CGGTCTGACATGGCAGCGCAAAGGGCGGCACGGTGGGCGACATTGAGAGTATGCCGTTTGTCGAGGCTCTGACGC
AGCTGCGGCACAAGGCGGGCAAGGCCAACTTTATCAACATCCACGTCTCATACATACCCATTGTCAATGGCGAGC
AAAAGACAAAACCAACCCAGTACGCTGTCAAGAGCGTCCGCAGTGCCGGCCTCATACCCGACTTGGTACGATGCC
AGCCAAAGGCTCTCGTCGAGGCTCTACCCCGCTGACCGACTGTTGCTACGCTTTGCAGATTGCTTGTCGTTGCGA
GCGCCCGCTCGAGCAGGTGACGATGGACAAGATTGCCCAGAGCTGCCAGGTCGAGGTGGAGCAAGTTGTTGCCGT
GCGCGACATGCCCACCATTTACCAGGTGCCCATTTTGCTCGAGCAGCAAGGCCTCTTGGATCTCCTGCGCCAGAC
ACTCAGCCTCGAGCAGGTGGCCCTGACACCCTCGCTCGTGGCCAAGGGGGCTGAGACGTGGCGCATGTGGAACGA
GATTATTCCCCAGGAGCATTCTGCCAAGCTGGACATTGCCCTGGTGGGCAAGTATGTTGAACTGCCCGATGCCTA
CCTGTCGACGGTCAAGTCGCTGGAGCACTCGGCCATGCGCTGCGGCCGCAAGCTCAACCTCATTTGGGTCGACTC
GGAGCAGCTCGAGGACAAGACGCAACGAAGTGATCCCGTTTGCTTCTACAAGGCCTGGCACCTTGTGTCGACGGC
CGCTGGCGTGCTCGTGCCTGGCGGATTCGGCCAGCGCGGCACCGAGGGCATGATCAAGGCGGCCCAGTGGGCTCG
TGAGCGCAAACGACCCTATCTGGGTGTCTGCCTGGGCATGCAGATTGCCGTCATCGAGTTTGCCCGACACGTGTG
CGCCATGGCCAATGCCACGTCGGAGGAGTTTGACGCGCAGGCCGAGCACCGCCTCATCATCTTCATGCCCGAGGG
CTCCAAGAACACCATGGGCGGCACCATGCGCCTGGGCTCGCGCGCCACCCACTTCCAGCCGGGCAGCGAGTACAG
CAAGCTGCGCGCCCTGTATGGCGAGGCGACTAGTATCCTGGAGCGCCACCGCCACCGCTACGAAGTTAACCCCGA
CTATGTCGATGCGCTTGACGCGGCCGGCATGACCTTTATCGGCAAGGACGACTCGGGCAACCGCATGGAGATTTT
TGAGCTTAAGGACCACCCTTGGTTTGTGGGTGTGCAGTATCACCCCGAGTACCTGAGTCGTGTGCTGGATCCCTC
GCGTCCCTATCTCGGCTTTGTTGCCGCTGCGGCTGGTTGTCTGGACCGCATAACGCAGCAGGCCTTGGAGCAGAC
AACAAATGGCCAATCTACTTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail