Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|554
Gene name
LocationContig_11:69035..71314
Strand+
Gene length (bp)2279
Transcript length (bp)1857
Coding sequence length (bp)1857
Protein length (aa) 619

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain 2.8E-16 111 215
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 5.7E-10 351 481
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 9.1E-07 232 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 114 395 4.0E-22
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 23 470 9.0E-20
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 62 471 2.0E-19
sp|Q9K9C6|BGAL_BACHD Beta-galactosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lacZ PE=3 SV=1 115 592 3.0E-19
sp|Q4FAT7|BGLR_PIG Beta-glucuronidase OS=Sus scrofa GN=GUSB PE=3 SV=1 54 470 6.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 114 395 4.0E-22
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 23 470 9.0E-20
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 62 471 2.0E-19
sp|Q9K9C6|BGAL_BACHD Beta-galactosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lacZ PE=3 SV=1 115 592 3.0E-19
sp|Q4FAT7|BGLR_PIG Beta-glucuronidase OS=Sus scrofa GN=GUSB PE=3 SV=1 54 470 6.0E-19
sp|P05804|BGLR_ECOLI Beta-glucuronidase OS=Escherichia coli (strain K12) GN=uidA PE=1 SV=2 62 470 1.0E-18
sp|P26257|BGAL_THETU Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes GN=lacZ PE=1 SV=1 77 464 2.0E-18
sp|O97524|BGLR_FELCA Beta-glucuronidase OS=Felis catus GN=GUSB PE=1 SV=1 51 470 5.0E-18
sp|A7LXS9|BGH2A_BACO1 Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02645 PE=1 SV=1 114 438 5.0E-18
sp|Q56307|BGAL_THEMA Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lacZ PE=3 SV=2 115 466 2.0E-17
sp|Q48727|BGAL_LACLA Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacZ PE=3 SV=3 62 448 5.0E-17
sp|P12265|BGLR_MOUSE Beta-glucuronidase OS=Mus musculus GN=Gusb PE=1 SV=2 62 470 2.0E-15
sp|Q5R5N6|BGLR_PONAB Beta-glucuronidase OS=Pongo abelii GN=GUSB PE=2 SV=2 113 470 3.0E-15
sp|P08236|BGLR_HUMAN Beta-glucuronidase OS=Homo sapiens GN=GUSB PE=1 SV=2 113 470 6.0E-15
sp|O77695|BGLR_CHLAE Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops GN=GUSB PE=2 SV=1 51 470 6.0E-15
sp|A1SWB8|BGAL_PSYIN Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) GN=lacZ PE=3 SV=1 119 480 3.0E-14
sp|O52847|BGAL_BACMD Beta-galactosidase OS=Bacillus megaterium (strain DSM 319) GN=bgaM PE=3 SV=1 61 393 3.0E-13
sp|P06864|BGA2_ECOLI Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) GN=ebgA PE=1 SV=4 115 466 3.0E-13
sp|P24131|BGAL_CLOAT Beta-galactosidase OS=Clostridium acetobutylicum GN=cbgA PE=2 SV=2 118 466 8.0E-13
sp|O33815|BGAL_STAXY Beta-galactosidase OS=Staphylococcus xylosus GN=lacZ PE=3 SV=1 132 466 1.0E-12
sp|Q59140|BGAL_ARTSB Beta-galactosidase OS=Arthrobacter sp. (strain B7) GN=lacZ PE=1 SV=1 115 438 2.0E-11
sp|P0C1Y0|BGAL_LACDE Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=lacZ PE=1 SV=2 117 479 2.0E-11
sp|Q1G9Z4|BGAL_LACDA Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=lacZ PE=3 SV=3 117 479 3.0E-11
sp|A0KQH4|BGAL_AERHH Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lacZ PE=3 SV=1 115 513 7.0E-11
sp|B4S2K9|BGAL_ALTMD Beta-galactosidase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=lacZ PE=3 SV=1 134 464 2.0E-10
sp|Q6LL68|BGAL_PHOPR Beta-galactosidase OS=Photobacterium profundum GN=lacZ PE=3 SV=1 5 464 3.0E-10
sp|Q5H7P5|EBM_LILLO Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum GN=EBM PE=1 SV=4 113 518 4.0E-10
sp|P81650|BGAL_PSEHA Beta-galactosidase OS=Pseudoalteromonas haloplanktis GN=lacZ PE=1 SV=2 14 464 8.0E-10
sp|B2VHN8|BGAL_ERWT9 Beta-galactosidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lacZ PE=3 SV=1 237 498 2.0E-09
sp|A8GGN3|BGAL_SERP5 Beta-galactosidase OS=Serratia proteamaculans (strain 568) GN=lacZ PE=3 SV=1 115 466 2.0E-09
sp|Q47077|BGAL1_ENTCL Beta-galactosidase OS=Enterobacter cloacae GN=lacZ PE=3 SV=1 119 466 3.0E-09
sp|Q03WL0|BGAL_LEUMM Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=lacZ PE=3 SV=1 134 466 4.0E-09
sp|A1JTC4|BGAL_YERE8 Beta-galactosidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lacZ PE=3 SV=1 134 464 4.0E-09
sp|A7MN76|BGAL_CROS8 Beta-galactosidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lacZ PE=3 SV=1 115 466 5.0E-09
sp|A3FEW8|BGAL_ENTAG Beta-galactosidase OS=Enterobacter agglomerans GN=lacZ PE=1 SV=2 119 466 6.0E-09
sp|Q2XQU3|BGAL2_ENTCL Beta-galactosidase 2 OS=Enterobacter cloacae GN=lacZ PE=3 SV=1 62 466 8.0E-09
sp|Q669R9|BGAL_YERPS Beta-galactosidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|A9R0J8|BGAL_YERPG Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|B2K6E6|BGAL_YERPB Beta-galactosidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|B1JI86|BGAL_YERPY Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|A7FH78|BGAL_YERP3 Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|Q1C6T8|BGAL_YERPA Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|Q7CIZ3|BGAL_YERPE Beta-galactosidase OS=Yersinia pestis GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|Q1CI76|BGAL_YERPN Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|A4TLL5|BGAL_YERPP Beta-galactosidase OS=Yersinia pestis (strain Pestoides F) GN=lacZ PE=3 SV=1 20 471 3.0E-08
sp|B1LIM9|BGAL_ECOSM Beta-galactosidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lacZ PE=3 SV=1 259 466 3.0E-08
sp|A4W7D2|BGAL_ENT38 Beta-galactosidase OS=Enterobacter sp. (strain 638) GN=lacZ PE=3 SV=1 225 466 5.0E-08
sp|A5F5U6|BGAL_VIBC3 Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=lacZ PE=3 SV=2 115 471 8.0E-08
sp|Q0CCA0|MANBB_ASPTN Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mndB PE=3 SV=2 207 438 1.0E-07
sp|P70753|BGAL_ACTPL Beta-galactosidase OS=Actinobacillus pleuropneumoniae GN=lacZ PE=3 SV=1 127 391 2.0E-07
sp|Q8D4H3|BGAL_VIBVU Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) GN=lacZ PE=3 SV=2 5 464 3.0E-07
sp|A8AKB8|BGAL_CITK8 Beta-galactosidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lacZ PE=3 SV=1 248 466 4.0E-07
sp|Q04F24|BGAL_OENOB Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=lacZ PE=3 SV=1 62 458 5.0E-07
sp|Q7MG04|BGAL_VIBVY Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) GN=lacZ PE=3 SV=1 134 464 9.0E-07
sp|Q5B7W2|MANBB_EMENI Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndB PE=1 SV=2 207 438 1.0E-06
sp|Q3Z583|BGAL_SHISS Beta-galactosidase OS=Shigella sonnei (strain Ss046) GN=lacZ PE=3 SV=1 259 466 6.0E-06
sp|P23989|BGAL_STRTR Beta-galactosidase OS=Streptococcus thermophilus GN=lacZ PE=3 SV=1 117 393 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999592

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH2 4.8E-99 57 486

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4559
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7657
Ophiocordyceps australis map64 (Brazil) OphauB2|554 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06300
Ophiocordyceps camponoti-rufipedis Ophun1|5496
Ophiocordyceps kimflemingae Ophio5|7311
Ophiocordyceps subramaniannii Hirsu2|954

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|554
MHLLSATIGCAALLSGLAQAEKRAPAPYQVQKPPLDTDWTYKVGTDPWPEYPRPQLRRSDWQSLNGIWTFQGLDG
NVADLESFAGVAPEREVLIPSCIESGLSGIQELGITNMWFERYFEVPQEWSNKTILLNFEAVDYETSVFVNNVKV
GSHVGGYFRFSFDITAHVKHGQENRLLVAVYDPTDTDVIPVGKQTVNPRHIWYRPCSGIWQSVWMEAVAPNYITK
LDVSAGMDGTVTFKAHSSQGSATPLTFSVLDASGSVVAKKCGTSDTELTAVVKDPLLWTPDSPHLYNISVTMGSD
KVASYTGFRTISSGRVEDVQRPLLNGRFVFMFGTLDQGYWPDGIYTPPNREAMVYDLKLLKSLGFNTVRKHIKVE
PALFYQACDELGLMVIQDMPSMPDDRNRLPNAAQQAEFERQLELLVNQLKSYTSIVTWIIYNEGWGQLRQAPYPE
EKLTKVVRSLDPTRLIDSVTGWHDHGFGDFSDNHHYANPQCGTPFSSIDSSPYDEKRIGFQGEFGGLGHVVDKHI
WNVQEAIDTINQTYEISQDLDAYNYRSHLVLGELREQVERYACSGGLWTQTTDVEGEVNGLYTYDRRVLRPYVKQ
WRDDIQSLYEAARARGGG*
Coding >OphauB2|554
ATGCATCTCTTATCCGCTACCATCGGCTGTGCTGCCCTGCTCAGTGGCCTCGCCCAGGCAGAGAAGCGCGCCCCA
GCGCCATACCAGGTGCAAAAGCCGCCTCTCGACACCGACTGGACGTACAAGGTGGGCACGGATCCCTGGCCCGAG
TATCCGCGGCCGCAGCTCCGGCGCAGCGACTGGCAAAGCCTCAATGGCATCTGGACCTTTCAAGGGCTCGACGGC
AACGTGGCGGACCTGGAATCCTTTGCGGGCGTGGCGCCGGAGCGAGAGGTCTTGATTCCGTCGTGTATCGAGAGC
GGGCTCTCTGGGATCCAGGAGCTCGGTATTACGAATATGTGGTTCGAGAGATACTTCGAGGTGCCGCAAGAGTGG
AGCAACAAGACCATTCTCCTCAATTTCGAAGCCGTCGACTATGAAACAAGCGTATTTGTCAACAATGTCAAGGTT
GGGAGCCATGTTGGCGGATACTTTCGCTTCAGCTTTGACATTACTGCTCATGTCAAGCATGGTCAGGAAAACCGC
CTACTAGTGGCCGTTTACGACCCGACAGACACGGATGTTATTCCCGTCGGCAAACAAACCGTCAATCCGAGACAC
ATTTGGTACCGGCCCTGCTCAGGAATCTGGCAGAGCGTATGGATGGAAGCCGTAGCGCCAAATTACATTACCAAG
CTTGATGTCTCTGCTGGCATGGACGGCACAGTTACCTTCAAGGCACACAGCTCGCAGGGAAGCGCCACGCCGCTC
ACCTTTTCCGTGCTAGACGCCAGCGGCAGCGTCGTTGCTAAAAAATGCGGCACCTCGGACACGGAGCTCACGGCC
GTGGTCAAGGACCCCTTGCTCTGGACGCCAGACTCGCCCCATCTCTACAACATTTCCGTCACCATGGGTTCCGAC
AAGGTGGCCAGCTATACCGGCTTCCGCACCATTTCCTCTGGCCGGGTGGAGGATGTGCAGCGGCCTCTGCTAAAC
GGCCGCTTCGTCTTCATGTTTGGCACGCTCGACCAGGGATACTGGCCAGACGGAATCTACACGCCGCCGAACCGA
GAGGCCATGGTTTACGACTTGAAGCTGCTAAAGTCGCTCGGCTTCAACACGGTTCGCAAACACATCAAGGTTGAG
CCGGCGCTCTTTTACCAGGCCTGTGACGAGCTGGGCTTAATGGTCATTCAAGACATGCCCAGCATGCCGGATGAT
CGGAACCGTCTGCCAAACGCGGCGCAGCAGGCTGAATTTGAGCGGCAGCTCGAGCTTCTCGTCAACCAGCTAAAG
AGCTACACGTCGATAGTAACATGGATCATTTACAATGAAGGATGGGGCCAGCTCCGGCAAGCACCATACCCAGAG
GAAAAACTTACAAAAGTGGTTCGAAGCCTGGATCCCACCAGGCTCATTGACTCGGTGACTGGCTGGCATGACCAC
GGCTTCGGTGATTTTTCGGATAACCACCACTACGCCAACCCTCAGTGCGGCACGCCCTTTTCCTCCATCGACTCT
TCTCCATATGATGAAAAACGCATCGGCTTCCAGGGCGAGTTTGGCGGCCTCGGCCACGTTGTGGATAAACATATT
TGGAATGTACAAGAAGCAATAGACACCATCAACCAGACGTACGAAATCAGCCAAGATCTCGACGCCTACAACTAT
AGATCTCACCTTGTCCTCGGGGAGCTTAGAGAGCAGGTTGAGCGGTATGCATGCAGCGGCGGGCTGTGGACGCAA
ACAACAGACGTCGAGGGCGAAGTCAATGGGCTCTACACATATGACCGCCGGGTATTACGCCCCTATGTCAAGCAG
TGGAGAGACGATATTCAAAGCCTGTACGAGGCAGCACGGGCGCGAGGCGGAGGATGA
Transcript >OphauB2|554
ATGCATCTCTTATCCGCTACCATCGGCTGTGCTGCCCTGCTCAGTGGCCTCGCCCAGGCAGAGAAGCGCGCCCCA
GCGCCATACCAGGTGCAAAAGCCGCCTCTCGACACCGACTGGACGTACAAGGTGGGCACGGATCCCTGGCCCGAG
TATCCGCGGCCGCAGCTCCGGCGCAGCGACTGGCAAAGCCTCAATGGCATCTGGACCTTTCAAGGGCTCGACGGC
AACGTGGCGGACCTGGAATCCTTTGCGGGCGTGGCGCCGGAGCGAGAGGTCTTGATTCCGTCGTGTATCGAGAGC
GGGCTCTCTGGGATCCAGGAGCTCGGTATTACGAATATGTGGTTCGAGAGATACTTCGAGGTGCCGCAAGAGTGG
AGCAACAAGACCATTCTCCTCAATTTCGAAGCCGTCGACTATGAAACAAGCGTATTTGTCAACAATGTCAAGGTT
GGGAGCCATGTTGGCGGATACTTTCGCTTCAGCTTTGACATTACTGCTCATGTCAAGCATGGTCAGGAAAACCGC
CTACTAGTGGCCGTTTACGACCCGACAGACACGGATGTTATTCCCGTCGGCAAACAAACCGTCAATCCGAGACAC
ATTTGGTACCGGCCCTGCTCAGGAATCTGGCAGAGCGTATGGATGGAAGCCGTAGCGCCAAATTACATTACCAAG
CTTGATGTCTCTGCTGGCATGGACGGCACAGTTACCTTCAAGGCACACAGCTCGCAGGGAAGCGCCACGCCGCTC
ACCTTTTCCGTGCTAGACGCCAGCGGCAGCGTCGTTGCTAAAAAATGCGGCACCTCGGACACGGAGCTCACGGCC
GTGGTCAAGGACCCCTTGCTCTGGACGCCAGACTCGCCCCATCTCTACAACATTTCCGTCACCATGGGTTCCGAC
AAGGTGGCCAGCTATACCGGCTTCCGCACCATTTCCTCTGGCCGGGTGGAGGATGTGCAGCGGCCTCTGCTAAAC
GGCCGCTTCGTCTTCATGTTTGGCACGCTCGACCAGGGATACTGGCCAGACGGAATCTACACGCCGCCGAACCGA
GAGGCCATGGTTTACGACTTGAAGCTGCTAAAGTCGCTCGGCTTCAACACGGTTCGCAAACACATCAAGGTTGAG
CCGGCGCTCTTTTACCAGGCCTGTGACGAGCTGGGCTTAATGGTCATTCAAGACATGCCCAGCATGCCGGATGAT
CGGAACCGTCTGCCAAACGCGGCGCAGCAGGCTGAATTTGAGCGGCAGCTCGAGCTTCTCGTCAACCAGCTAAAG
AGCTACACGTCGATAGTAACATGGATCATTTACAATGAAGGATGGGGCCAGCTCCGGCAAGCACCATACCCAGAG
GAAAAACTTACAAAAGTGGTTCGAAGCCTGGATCCCACCAGGCTCATTGACTCGGTGACTGGCTGGCATGACCAC
GGCTTCGGTGATTTTTCGGATAACCACCACTACGCCAACCCTCAGTGCGGCACGCCCTTTTCCTCCATCGACTCT
TCTCCATATGATGAAAAACGCATCGGCTTCCAGGGCGAGTTTGGCGGCCTCGGCCACGTTGTGGATAAACATATT
TGGAATGTACAAGAAGCAATAGACACCATCAACCAGACGTACGAAATCAGCCAAGATCTCGACGCCTACAACTAT
AGATCTCACCTTGTCCTCGGGGAGCTTAGAGAGCAGGTTGAGCGGTATGCATGCAGCGGCGGGCTGTGGACGCAA
ACAACAGACGTCGAGGGCGAAGTCAATGGGCTCTACACATATGACCGCCGGGTATTACGCCCCTATGTCAAGCAG
TGGAGAGACGATATTCAAAGCCTGTACGAGGCAGCACGGGCGCGAGGCGGAGGATGA
Gene >OphauB2|554
ATGCATCTCTTATCCGCTACCATCGGCTGTGCTGCCCTGCTCAGTGGCCTCGCCCAGGCAGAGAAGCGCGCCCCA
GCGCCATACCAGGTGCAAAAGCCGCCTCTCGACACCGACTGGACGTACAAGGTGGGCACGGATCCCTGGCCCGAG
TATCCGCGGCCGCAGCTCCGGCGCAGCGACTGGCAAAGCCTCAATGGCATCTGGACCTTTCAAGGGCTCGACGGC
AACGTGGCGGACCTGGAATCCTTTGCGGGCGTGGCGCCGGAGCGAGAGGTCTTGATTCCGTCGTGTATCGAGAGC
GGGCTCTCTGGGATCCAGGAGCTCGGTATTACGAATATGTGGTTCGAGAGATACTTCGAGGTGCCGCAAGAGTGG
AGCAACAAGACCATTCTCCTCAATTTCGAAGCCGTCGACTATGAAACAAGCGTATTTGTCAACAATGTCAAGGTT
GGGAGCCATGTTGGCGGATACTTTCGCTTCAGCTTTGACATTACTGCTCATGTCAAGCATGGTCAGGAAAACCGC
CTGTAAGAAGAAGCCGTCACGTCAAAGAGGAGCAAAATAAAACAAACCAAAAAAAAAAACAAGCACTAACCATCG
AGATATGCGCCGTGCAGACTAGTGGCCGTTTACGACCCGACAGACACGGATGTTATTCCCGTCGGCAAACAAACC
GTCAATCCGAGACACATTTGGTACCGGCCCTGCTCAGGAATCTGGCAGAGCGTATGGATGGAAGCCGTAGCGCCA
AATTACATTACCAAGCTTGATGTCTCTGCTGGCATGGACGGCACAGGCAAGCTTTGCCCAGTAGCCCGTCATTTC
ATTACACACCACTAACACCCCTCCCCCCCCCCAGTTACCTTCAAGGCACACAGCTCGCAGGGAAGCGCCACGCCG
CTCACCTTTTCCGTGCTAGACGCCAGCGGCAGCGTCGTTGCTAAAAAATGCGGCACCTCGGACACGGAGCTCACG
GCCGTGGTCAAGGACCCCTTGCTCTGGACGCCAGACTCGCCCCATCTCTACAACATTTCCGTCACCATGGGTTCC
GACAAGGTGGCCAGCTATACCGGCTTCCGCACCATTTCCTCTGGCCGGGTGGAGGATGTGCAGCGGCCTCTGCTA
AACGGCCGCTTCGTCTTCATGTTTGGCACGCTCGACCAGGGATACTGGCCAGACGGAATCTACACGCCGCCGAAC
CGAGAGGCCATGGTTTACGACTTGAAGCTGCTAAAGTCGCTCGGCTTCAACACGGTTCGCAAACACGTATGCTCA
TGATTGCTTTTGCCGTCTTAAGAGCCATGGACTCTACTTACCAAGACTGCGAGTACAGATCAAGGTTGAGCCGGC
GCTCTTTTACCAGGCCTGTGACGAGCTGGGCTTAATGGTCATTCAAGACATGCCCAGCATGCCGGATGATCGGAA
CCGTCTGCCAAACGCGGCGCAGCAGGCTGAATTTGAGCGGCAGCTCGAGCTTCTCGTCAACCAGCTAAAGAGCTA
CACGTCGATAGTAACATGGGTGAGTCGATGAGCGTGTCATGCTTGGAAAGCTAGTGATTGACATTTTTCCTCCCT
TGTCGAATAGATCATTTACAATGAAGGATGGGGCCAGCTCCGGCAAGCACCATACCCAGAGGAAAAACTTACAAA
AGTGGTTCGAAGCCTGGATCCCACCAGGCTCATTGACTCGGTGACTGGCTGGCATGACCACGGCTTCGGTGATTT
TTCGGTAGGATGGTCGAGCAACAGCTCGTGGTTGCTAGTACATGGACTAACGAGGCAAAATTCCCCAGGATAACC
ACCACTACGCCAACCCTCAGTGCGGCACGCCCTTTTCCTCCATCGACTCTTCTCCATATGATGAAAAACGCATCG
GCTTCCAGGGCGAGTTTGGCGGCCTCGGCCACGTTGTGGATAAACAGTAAGCCCCCCTCTCCCTCCCTCTGCCAA
GGCCCACGACGACGGAAAAAAAAAAATAACTCTGGTGCCACAGTATTTGGAATGTACAAGAAGCAATAGACACCA
TCAACCAGACGTACGAAATCAGCCAAGATCTCGACGCCTACAACTATAGATCTCACCTTGTCCTCGGGGAGCTTA
GAGAGCAGGTTGAGCGGTATGCATGCAGCGGCGGGCTGTGGACGCAAACAACAGACGTCGAGGGCGAAGTCAATG
GGCTCTACACATATGACCGCCGGGTATTACGCCCCTATGTCAAGCAGTGGAGAGACGATATTCAAAGCCTGTACG
AGGCAGCACGGGCGCGAGGCGGAGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail